KEGG   Aedes albopictus (Asian tiger mosquito): 109411508
Entry
109411508         CDS       T06060                                 
Name
(RefSeq) LOW QUALITY PROTEIN: cytochrome P450 306a1-like
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
aalb  Aedes albopictus (Asian tiger mosquito)
Pathway
aalb00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:aalb00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    109411508
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:aalb00199]
    109411508
Enzymes [BR:aalb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     109411508
Cytochrome P450 [BR:aalb00199]
 Cytochrome P450, animal type
  CYP306 family
   109411508
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 109411508
NCBI-ProteinID: XP_029723479
LinkDB
Position
Unknown
AA seq 510 aa
MYLILGIILILTYVLWTLLDRRGKPPGPFGLPIIGYLPFIDSVKPYETLTKLAKRYGPVY
SLRMGQVDAVVLSSPELIRDTLKREETTGRAPLFITHGIMGGYGIICAEGNLWRDQRRLS
TEWLRKMGMTKFGPTRSTLEARILIGVNELLQDLKRESEKVFAFDPAPLLHHILGNLMND
IVFGLQYERDDATWRYLQHLQEEGVKHIGVSMAVNFLPFLRHLPSSKRIIEFLLNGKAKT
HKIYDSIIEKQRSTLMTAAAAAGDGPEVNDPPQQRLQRDCILSNFLQETRRRESGGRPEL
AFCSDVQLRHLLADLFGAGVDTTFTTLRWLILFLALNKDVQQRLRQEMAARLQSEPCLND
IDSLPYLKACVAEAQRLTTVVPLGIPHGAVSDITIAGFKVPKNTMIIPLLWAVHMDPSLW
RNPDRFDPNHFLDDAGQYVTPSHFMPFQTGKRMCLGDELARMILMLYTGRLFWNFELDLF
NGDALDLTGVCGITLTPPPFEVVFKECSKK
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgtacttaatcctcggtattattttaatcctaacctacgtgctatggaccctactggac
cgccgcggaaaaccacctggcccattcgggttaccgatcatcggttacctgcccttcatt
gactcggtcaaaccgtacgaaacgctcaccaagctcgccaaacgctacggccccgtctac
agcctgcggatgggccaggtggacgcagtagttctaagcagcccggaactcatccgcgat
accctgaagcgagaagaaaccaccggaagggcaccgctcttcattactcatgggatcatg
ggaggatatggaatcatctgcgcagaaggcaatctatggcgggatcagcggcgtctctcg
accgaatggctgcgcaagatgggcatgacgaaattcggcccaacgcgttcaacgctcgaa
gcccgcatcttaatcggtgtcaatgaactcctacaggatttgaagagagaatcggagaaa
gtgtttgcgttcgatcctgcaccgttgctgcatcacattctaggaaatctgatgaatgac
atcgtgttcgggctgcagtacgagcgggatgacgcaacgtggcgatatctgcagcatctc
caggaggagggcgtcaaacatatcggagtatcgatggcggttaatttcctaccgtttttg
agacatctgccttcgagcaaaaggataattgaatttttattaaatggtaaagcaaaaacc
cataaaatttacgactcgatcatcgaaaagcagcgcagcaccctgatgacggcggcagcg
gcggctggtgacggtcccgaggtcaacgacccaccacaacaacggttgcaacgcgattgc
atcctgtcgaatttcctgcaggaaacccgtcgaagggaaagcggcggccgcccggagctg
gccttctgcagcgacgtccaactgcggcatctgctggcggatttgttcggggcaggtgtg
gacaccacgtttacgacccttcgctggttgattctgtttctggccttgaataaggatgtg
cagcaacggttgcggcaggagatggccgctcggcttcagtcggagccgtgcttgaacgat
atcgactcgttgccgtatctgaaagcgtgcgtggccgaagcgcagcggttgacaacggtc
gttcctcttgggattccacatggagcggtgtcggacatcacaatcgccggcttcaaggta
ccgaaaaacaccatgataatcccgctgctatgggccgtccacatggacccatccctgtgg
cgcaacccggaccgcttcgatccgaaccacttcctggacgacgccggccaatacgtcacc
ccttcgcatttcatgccgttccaaaccggcaagcggatgtgcctcggagacgaactggcc
cgcatgattctgatgttgtacacggggcgactcttctggaacttcgaactggacttgttc
aatggggatgcgttggacttgacgggggtttgcggaataactcttaccccaccgccgttc
gaggttgtttttaaggagtgttcgaagaagtaa

DBGET integrated database retrieval system