Aedes albopictus (Asian tiger mosquito): 109412580 Help Entry 109412580         CDS       T06060                                  Name (RefSeq) elongin-B-like isoform X1   KO K03873   elongin-B Organism aalb  Aedes albopictus (Asian tiger mosquito) Pathway aalb04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:aalb00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     109412580  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:aalb04121]     109412580    03400 DNA repair and recombination proteins [BR:aalb03400]     109412580 Ubiquitin system [BR:aalb04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      109412580    Cul5 complex      109412580 DNA repair and recombination proteins [BR:aalb03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      109412580 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD GABP-alpha Motif Other DBs NCBI-GeneID:  109412580 NCBI-ProteinID:  XP_019541749 UniProt:  A0A023EF79 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MDVFMMIRRKKTTIFTDAKETTPVHELKRMIEGILKVPPRDQRLYNKDNQLMDDDRTLQD CGITVATAKAQCPAQLGLAIRENSGDFEQLDLTPYSLPPDLPDVMKNQDAANGQDQLA NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggatgtcttcatgatgatcagacggaagaagaccaccatcttcaccgatgccaaagaa acgactccggtgcacgagctgaagcgaatgatcgaaggaatcctcaaagtgcctccccgg gaccagcgcctgtacaacaaggacaaccaactgatggacgacgaccggacgctgcaggat tgcggcatcacggtggccaccgccaaggcacagtgtccggcccagctcgggttggccatc cgggaaaatagcggcgacttcgagcagctggatctgactccgtactcgctgccgccggat ctaccggacgtgatgaagaaccaggacgcggccaacggacaggaccaacttgcctaa

DBGET integrated database retrieval system