Aedes albopictus (Asian tiger mosquito): 109420207 Help Entry 109420207         CDS       T06060                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism aalb  Aedes albopictus (Asian tiger mosquito) Pathway aalb04013   MAPK signaling pathway - fly aalb04145   Phagosome aalb04148   Efferocytosis aalb04310   Wnt signaling pathway aalb04620   Toll-like receptor signaling pathway aalb05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:aalb00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     109420207    04310 Wnt signaling pathway     109420207  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     109420207    04148 Efferocytosis     109420207  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109420207  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     109420207  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aalb04131]     109420207   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aalb04147]     109420207    04031 GTP-binding proteins [BR:aalb04031]     109420207 Membrane trafficking [BR:aalb04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     109420207  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     109420207   Macropinocytosis    Ras GTPases     109420207  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     109420207 Exosome [BR:aalb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109420207   Exosomal proteins of other body fluids (saliva and urine)    109420207   Exosomal proteins of colorectal cancer cells    109420207   Exosomal proteins of bladder cancer cells    109420207 GTP-binding proteins [BR:aalb04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     109420207 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  109420207 NCBI-ProteinID:  XP_019550075 UniProt:  A0A023EIV8 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPNIPIILVGTKLDLR DDKQTVDKLRDKKLSPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPI IPVKNKRKCSIL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggccatcaagtgcgtcgttgttggcgatggtgccgtgggtaagacctgtttgctg atcagctacacgaccaatgccttcccgggagagtacattccgaccgtgttcgacaactat tctgcaaacgtcatggtcgatggaaagccaatcaacctgggactgtgggatacggccgga caggaagattacgatcgccttaggccgctgtcctacccgcagacggacgtgtttctcata tgcttctcgctggtcaatccggcctcgttcgagaacgtccgggccaagtggtatccggag gtgcgtcaccactgtccgaacataccgataatcctggtcggcaccaaacttgatctccgg gatgacaaacaaaccgtggataaactgcgcgacaagaagctgtccccgataacgtaccca cagggactggccatggcaaaggagatcggcgccgtcaaatatctggaatgttctgccctg acccaaaagggcctcaaaaccgttttcgacgaagcgatccgagccgtcctctgtcccatc ataccggtgaaaaacaaacgtaaatgttcaattctgtaa

DBGET integrated database retrieval system