Aedes albopictus (Asian tiger mosquito): 109423569 Help Entry 109423569         CDS       T06060                                  Name (RefSeq) protein chibby homolog 1   KO K23402   protein chibby 1 Organism aalb  Aedes albopictus (Asian tiger mosquito) Pathway aalb04310   Wnt signaling pathway Brite KEGG Orthology (KO) [BR:aalb00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     109423569  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:aalb03037]     109423569 Cilium and associated proteins [BR:aalb03037]  Primary cilia and associated proteins   Other primary cilia associated proteins    109423569 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Chibby TMD0_ABC Motif Other DBs NCBI-GeneID:  109423569 NCBI-ProteinID:  XP_019554097 UniProt:  A0AAA9ZXI9 LinkDB All DBs Position Unknown AA seq 124 aa AA seqDB search MPIFTKKFAPKVAPPRTTRLNIGCPPHQEDLDEFRNIRLNLLDKQLCFVDGVWISAAAAG TAPVAGSSGMTALSASTTAIDDLLRMKRRIKTLEQENNLYQVKLDVLLDLLTENVIELSA VKGQ NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgccaatttttacgaaaaagtttgcaccaaaagtggctcccccgcgtacgacacggctc aacattggctgcccgccgcaccaggaagacctggacgagttccgcaacattcggctgaac ctgctcgataagcaactgtgcttcgtcgatggggtttggataagtgccgctgcagccggg acagctcccgttgctggttcctcggggatgacggctttgtctgcctccaccaccgccatc gacgatctgctgcgaatgaaacgacgcatcaaaacgctcgaacaggagaacaatctgtac caggtgaagttggacgtgctgctggacctgctgacggagaacgtaatcgaactgagcgcg gtaaaaggtcaataa

DBGET integrated database retrieval system