Aedes albopictus (Asian tiger mosquito): 109427482 Help Entry 109427482         CDS       T06060                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism aalb  Aedes albopictus (Asian tiger mosquito) Brite KEGG Orthology (KO) [BR:aalb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:aalb03041]     109427482   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aalb04052]     109427482 Spliceosome [BR:aalb03041]  Complex B   Other components    Complex B specific factors     109427482 Cytokines and neuropeptides [BR:aalb04052]  Neuropeptides   Unclassified    109427482 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler OTU1_UBXL Motif Other DBs NCBI-GeneID:  109427482 NCBI-ProteinID:  XP_019558579 UniProt:  A0A023EDS9 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MLEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTRYDKIVLKKWYTIFKDNIKLSDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgttggaaattacgtgtaacgatcggctgggcaagaaggttcgagtgaaatgcaatcca gacgacaccatcggagatctgaagaagctcattgccgcacaaacgggaacccggtacgat aagattgtgctgaagaagtggtacaccatcttcaaggataatatcaagctatcggattac gagatccacgatggaatgaatttggagttgtactaccaatga

DBGET integrated database retrieval system