Aedes albopictus (Asian tiger mosquito): 115253428 Help Entry 115253428         CDS       T06060                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism aalb  Aedes albopictus (Asian tiger mosquito) Pathway aalb04013   MAPK signaling pathway - fly aalb04145   Phagosome aalb04148   Efferocytosis aalb04310   Wnt signaling pathway aalb04517   IgSF CAM signaling aalb04518   Integrin signaling aalb04620   Toll-like receptor signaling pathway aalb05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:aalb00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     115253428    04310 Wnt signaling pathway     115253428   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     115253428    04518 Integrin signaling     115253428  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     115253428    04148 Efferocytosis     115253428  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     115253428  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     115253428  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aalb04131]     115253428   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aalb04147]     115253428    04031 GTP-binding proteins [BR:aalb04031]     115253428 Membrane trafficking [BR:aalb04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     115253428  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     115253428   Macropinocytosis    Ras GTPases     115253428  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     115253428 Exosome [BR:aalb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    115253428   Exosomal proteins of other body fluids (saliva and urine)    115253428   Exosomal proteins of colorectal cancer cells    115253428   Exosomal proteins of bladder cancer cells    115253428 GTP-binding proteins [BR:aalb04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     115253428 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  115253428 NCBI-ProteinID:  XP_029718033 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPNIPIILVGTKLDLR DDKQTVDKLRDKKLSPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPI IPVKNKRKCSIL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggccatcaagtgcgtcgttgttggcgatggtgccgtgggtaagacctgtttgctg atcagctacacgaccaatgccttcccgggagagtacattccgaccgttttcgacaactat tctgcaaacgtcatggtcgatggaaagccaatcaacctgggactgtgggatacggccgga caggaagattacgatcgccttaggccgctgtcctacccgcagacggacgtgtttctcata tgcttctcgctggtcaatccggcctcgttcgagaacgtccgggccaagtggtatccggag gtgcgtcaccactgtccgaacataccgataatcctggtcggcaccaaactcgatctccgg gatgacaaacaaaccgtggataaactgcgcgacaagaagctgtccccgataacataccca caggggctggccatggcaaaggagatcggcgccgtcaaatatctggaatgttctgccctg acccaaaagggcctcaaaaccgttttcgacgaagcgatccgagccgtcctctgtcccatc ataccggtgaaaaacaaacgtaaatgttcaattctgtaa

DBGET integrated database retrieval system