KEGG   Anopheles albimanus: 118464094
Entry
118464094         CDS       T08930                                 
Name
(RefSeq) putative sodium-coupled neutral amino acid transporter 11
  KO
K14997  solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 11
Organism
aali  Anopheles albimanus
Brite
KEGG Orthology (KO) [BR:aali00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aali02000]
    118464094
Transporters [BR:aali02000]
 Solute carrier family (SLC)
  SLC38: System A and System N sodium-coupled neutral amino acid transporter
   118464094
SSDB
Motif
Pfam: Aa_trans Trp_Tyr_perm
Other DBs
NCBI-GeneID: 118464094
NCBI-ProteinID: XP_035787052
LinkDB
Position
3:51548587..51573065
AA seq 506 aa
MDNGNGSNKKNTVSEFSYMLQRQGSDDSVEASAFDDINSLMKREDGSKPVEQTLSSLPQA
SFNYINSIVGSGVIGIPYALHRAGFGLGLFLLVIVAVITDYSLILMVRCGHLSGRFSYPG
VMEAAYGKAGYYLLSLLQFMYPFLAMISYNVVVGDTLSKVLVRLVPSWGSSMGGVRFGVV
LVVTIFVVIPLCLYKNVSRLAKASFLSLACVVLILLAVVYRLLSGDYAVVPDTPESWRFA
HTDLIPAVGIMAFAFMCHHNTFLVYQSMQDATMERWEKVTHISVGFAWLVAALFGIAGYC
TFRALSQGDLLENYCWDDDLMNFARVLFSVSILLTFPIECFVSREIVRTQVRRFYSHEAV
EYDTDADPSHVTGEEDDRQSMITTLVIVFAAFIISPYTECLGPVLELNGLLAAIPLAYVL
PGLAYIQLSPHSLFSQEKLPAAGLVLFGTIVTISGAAILMPNLIGDCRTGIIMGYCKDDE
LALNGTASFVGMAASTVAPNCVTDKV
NT seq 1521 nt   +upstreamnt  +downstreamnt
atggataacggcaacggcagcaacaagaagaacaccgtgtccgagttcagctacatgctg
cagcgacaaggcagtgacgattctgtcgaggcgagcgccttcgatgacatcaactcgttg
atgaagcgcgaggatggcagcaaaccggtggagcaaacgctctcttcgctgccgcaggca
tcgtttaactacatcaactccatcgtgggcagcggcgtcatcgggatcccttatgccctg
caccgggccggcttcgggcttggcctctttctgctggtgatcgtcgcggtcattaccgac
tactcgctcatcctgatggttcgttgcggtcacctgagcggacggttcagctatcccggt
gtgatggaggcggcgtacgggaaggcgggctactatctgctttcgttgctccaatttatg
tacccatttctagccatgatctcgtacaatgtggtcgtcggtgatacgctgtcgaaggtg
ctggtacgcctggtaccgtcctggggtagctcgatgggtggcgtgcggttcggtgtggtg
ctggtcgtgaccatcttcgtggtgataccgctctgtctgtacaagaacgtgtcccggttg
gcgaaggcgagcttccttagcctcgcctgcgtcgtactgatactgttggctgtcgtctat
cggctcctgtccggtgattacgccgtcgttccggacacaccggagtcctggcggttcgca
cacacggatctgattccagccgtcggtattatggcgttcgcattcatgtgtcatcacaac
acgttcctggtgtaccaatcgatgcaggacgccacgatggagcgctgggagaaggtgacg
cacatttcggttggattcgcctggctagtggccgcactgttcggtatcgccggttactgt
accttccgggcactgtcacaaggtgatctgctggagaactactgctgggatgatgatctg
atgaactttgcgcgcgtcctgttctccgtctccatcctgctgaccttcccgatcgagtgc
ttcgtatcgcgggagatcgtaaggacgcaggtgcgtcggttttactcgcacgaggccgtc
gagtacgatacggatgcggatccgagccacgtcaccggtgaggaggacgatcggcaatca
atgatcacgacgctagtgatagtgtttgctgccttcattatctcaccgtataccgagtgt
ctcgggccggtgctggagctaaacggcttgctggcagccattccgttggcttacgtgctg
cctgggctggcctatatccagctcagtccccattcgctgtttagccaggagaagctaccg
gccgccgggctggtcctgttcggtaccatcgtcactatctccggggcggccatcctgatg
ccgaacctgattggcgactgccggaccggcatcatcatgggctactgtaaggacgacgag
ttagcgttgaacgggacggcatcgttcgtcggaatggcggcctccactgtggcgccgaat
tgtgtgacggataaggtctaa

DBGET integrated database retrieval system