Anopheles albimanus: 118466550 Help Entry 118466550         CDS       T08930                                  Name (RefSeq) ras-related protein Rac1-like   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism aali  Anopheles albimanus Pathway aali04013   MAPK signaling pathway - fly aali04145   Phagosome aali04148   Efferocytosis aali04310   Wnt signaling pathway aali04620   Toll-like receptor signaling pathway aali05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:aali00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     118466550    04310 Wnt signaling pathway     118466550  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     118466550    04148 Efferocytosis     118466550  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     118466550  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     118466550  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aali04131]     118466550   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aali04147]     118466550    04031 GTP-binding proteins [BR:aali04031]     118466550 Membrane trafficking [BR:aali04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     118466550  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     118466550   Macropinocytosis    Ras GTPases     118466550  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     118466550 Exosome [BR:aali04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118466550   Exosomal proteins of other body fluids (saliva and urine)    118466550   Exosomal proteins of colorectal cancer cells    118466550   Exosomal proteins of bladder cancer cells    118466550 GTP-binding proteins [BR:aali04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     118466550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  118466550 NCBI-ProteinID:  XP_035791957 LinkDB All DBs Position 3:complement(65635974..65645047) Genome browser AA seq 198 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPNIPIILVGTKLDLR DDKNTVDKLRDKKLSPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPM IPPKKKPKSHPLWRLCSY NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgcaagctatcaaatgtgtcgtcgtcggagacggtgcggtcggtaagacgtgtctgctg atcagctacacgacgaacgccttcccgggcgagtacataccgaccgtgttcgacaactac tcggcaaacgtgatggtcgacagcaaaccgatcaacctgggcctatgggatacggccgga caggaggattacgatcggctgcggccgctttcctatccgcagacagacgtctttctgatt tgcttttcgctcgtcaatccggcctcgttcgagaacgtgcgggcaaagtggtacccggag gtgcgccatcactgtccgaacataccgatcatactggtcggcacgaagctcgacctgcgg gacgacaagaacacggtggacaagctgcgcgacaagaagctgtcgccgatcacctatccg caggggttggcaatggcgaaggagatcggtgcggtgaagtacctcgagtgctcggccctc acgcagaagggcctcaagacggtgttcgacgaagcgatccgggcggtgctctgcccgatg ataccgcccaaaaagaaacctaagtcacatccattgtggcgcctgtgttcgtactaa

DBGET integrated database retrieval system