Abyssibius alkaniclasticus: LGT41_0014195 Help Entry LGT41_0014195     CDS       T08825                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aalk  Abyssibius alkaniclasticus Pathway aalk01100   Metabolic pathways aalk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aalk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LGT41_0014195    00074 Mycolic acid biosynthesis     LGT41_0014195   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LGT41_0014195 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  UPH70920 LinkDB All DBs Position complement(2861671..2861904) Genome browser AA seq 77 aa AA seqDB search MSDIADRIKKIVIEHLSVDADKVTENASFIDDLGADSLDTVELVMAFEEEFGIEIPDEAA ETIQSFGDAVKYVTENS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacattgcagatcgcattaaaaagatcgtcatcgagcatctgagcgttgacgcc gacaaggtgactgagaatgcgtcgttcatcgacgatctgggcgctgacagccttgacacc gttgaactggtgatggcgttcgaagaagaattcggtatcgaaattcccgacgaagccgcc gagaccatccagtctttcggcgatgccgtcaaatacgtgaccgaaaactcctga

DBGET integrated database retrieval system