Aeromonas allosaccharophila: I6G90_20545 Help Entry I6G90_20545       CDS       T07074                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aall  Aeromonas allosaccharophila Pathway aall01100   Metabolic pathways aall01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aall00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     I6G90_20545    00074 Mycolic acid biosynthesis     I6G90_20545   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     I6G90_20545 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Phytase Motif Other DBs NCBI-ProteinID:  QPR54748 UniProt:  A0A7T2PFB3 LinkDB All DBs Position complement(4477054..4477314) Genome browser AA seq 86 aa AA seqDB search MQQTLTEEIKQLIIDSLNLEGMTTADIDTDAPLFNDGLGLDSIDALELGLAIKGRYGIVL SADDENTRRHFASVAALAALVNQQRG NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgcaacaaacattaactgaagaaatcaaacaactgatcatcgacagcctcaacctcgaa ggcatgacgactgccgatatcgacaccgacgccccgctcttcaatgacggtctcgggctc gactccatcgatgcactggagctgggactggcgatcaagggacgctacggcatcgtgctc tcggctgatgacgagaatacccgtcgtcactttgcctctgttgcagccctggctgccctc gtcaaccagcagcggggataa

DBGET integrated database retrieval system