Alternaria alternata: CC77DRAFT_1043671 Help Entry CC77DRAFT_1043671 CDS       T05291                                  Name (RefSeq) dynein light chain type 1   KO K10418   dynein light chain LC8-type Organism aalt  Alternaria alternata Pathway aalt04145   Phagocytosis aalt04517   IgSF CAM signaling aalt04814   Motor proteins Brite KEGG Orthology (KO) [BR:aalt00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     CC77DRAFT_1043671  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     CC77DRAFT_1043671   09142 Cell motility    04814 Motor proteins     CC77DRAFT_1043671  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:aalt03037]     CC77DRAFT_1043671    04812 Cytoskeleton proteins [BR:aalt04812]     CC77DRAFT_1043671 Cilium and associated proteins [BR:aalt03037]  Motile cilia and associated proteins   Dynein arm    CC77DRAFT_1043671 Cytoskeleton proteins [BR:aalt04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      CC77DRAFT_1043671 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light WHD_GDS1 Motif Other DBs NCBI-GeneID:  29112920 NCBI-ProteinID:  XP_018381401 JGI:  1043671 UniProt:  A0A177D9W9 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search MASDKSDAHKQDAQIKSADMSEEMQQEAIEVAQSAMEQFTIEKDIAQYIKKEFDSRKGAT WHCIVGRNFGSFVTHETKHFIYFYLGHCAILLFKTQ NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggctagcgacaagtcagatgcccacaagcaggatgctcaaatcaagtccgccgacatg agtgaggaaatgcaacaagaggctattgaagtcgcacagtcggctatggagcagttcact atcgagaaggacattgcccagtatatcaagaaggagttcgacagccgaaagggtgccaca tggcactgcatcgtaggtcgcaactttggaagctttgtcacacatgagacgaaacacttc atctacttttacctcggtcactgtgccatcctacttttcaagactcagtag

DBGET integrated database retrieval system