KEGG   Alternaria alternata: CC77DRAFT_1050726
Entry
CC77DRAFT_1050726 CDS       T05291                                 
Name
(RefSeq) E3 ubiquitin ligase SCF complex, Skp subunit
  KO
K03094  S-phase kinase-associated protein 1
Organism
aalt  Alternaria alternata
Pathway
aalt03083  Polycomb repressive complex
aalt04111  Cell cycle - yeast
aalt04120  Ubiquitin mediated proteolysis
aalt04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:aalt00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CC77DRAFT_1050726
   04120 Ubiquitin mediated proteolysis
    CC77DRAFT_1050726
  09126 Chromosome
   03083 Polycomb repressive complex
    CC77DRAFT_1050726
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    CC77DRAFT_1050726
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aalt04131]
    CC77DRAFT_1050726
   04121 Ubiquitin system [BR:aalt04121]
    CC77DRAFT_1050726
   03036 Chromosome and associated proteins [BR:aalt03036]
    CC77DRAFT_1050726
Membrane trafficking [BR:aalt04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    CC77DRAFT_1050726
Ubiquitin system [BR:aalt04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     CC77DRAFT_1050726
   Cul7 complex
     CC77DRAFT_1050726
Chromosome and associated proteins [BR:aalt03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     CC77DRAFT_1050726
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     CC77DRAFT_1050726
SSDB
Motif
Pfam: Skp1 Skp1_POZ
Other DBs
NCBI-GeneID: 29113230
NCBI-ProteinID: XP_018385100
JGI: 1050726
UniProt: A0A177DLI1
LinkDB
Position
Unknown
AA seq 169 aa
MASTTAEGVKLISITTSDGVEMKVERPVAERSILIKNLLEDLGGESEESIPIPNVNEAVM
KKVVEWCGHHKNDPPATQDDDSDSRKKSTDIDEWDQKFMQVDQEMLFEIILAANYLDIKA
LLDVGCKTVANMIKGKSPDEIRKTFNIQNDFTPEEEEQIRRENEWAEDR
NT seq 510 nt   +upstreamnt  +downstreamnt
atggcttccactactgccgagggcgtcaagctcatcagcattaccacctccgatggtgtc
gagatgaaggtcgagcgccctgtcgctgagcgctccatcctcatcaagaacttgctcgag
gatctcggtggtgaatccgaggagtctatccccatccccaacgtaaacgaggcagtcatg
aagaaggttgtcgagtggtgtggccaccacaagaacgaccctcccgccacccaggacgac
gactccgactcgcgcaagaagtccaccgacatcgacgagtgggatcagaagttcatgcag
gtcgaccaggagatgcttttcgagatcatcctcgccgccaactacctggacatcaaggct
ctcctcgacgtaggatgcaagaccgtcgcgaacatgatcaagggcaagtcacccgatgag
atccgtaagaccttcaacatccagaacgacttcacccccgaggaggaggagcagatccgc
cgcgagaacgagtgggctgaggaccgctaa

DBGET integrated database retrieval system