Alternaria alternata: CC77DRAFT_1060931 Help Entry CC77DRAFT_1060931 CDS       T05291                                  Name (RefSeq) LSM-domain-containing protein   KO K12624   U6 snRNA-associated Sm-like protein LSm5 Organism aalt  Alternaria alternata Pathway aalt03018   RNA degradation aalt03040   Spliceosome Brite KEGG Orthology (KO) [BR:aalt00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     CC77DRAFT_1060931   09123 Folding, sorting and degradation    03018 RNA degradation     CC77DRAFT_1060931  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:aalt03019]     CC77DRAFT_1060931    03041 Spliceosome [BR:aalt03041]     CC77DRAFT_1060931 Messenger RNA biogenesis [BR:aalt03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      CC77DRAFT_1060931   mRNA degradation factors    5'-3' decay     Lsm complex      CC77DRAFT_1060931 Spliceosome [BR:aalt03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     CC77DRAFT_1060931 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM SM-ATX VWA_3_C LSM12_LSM CooT DUF150_C Motif Other DBs NCBI-GeneID:  29113966 NCBI-ProteinID:  XP_018386664 JGI:  1060931 UniProt:  A0A177DN64 LinkDB All DBs Position Unknown AA seq 86 aa AA seqDB search MSLENLLPLELIDKCVGSQIWVIMNGGKEFTGKLVGFDDYVNMVLENVTEIDPAEGNVQL PKILLNGNNICMMVPGGDGQTVLEDE NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtcgctcgagaacctccttccgctagaactcatcgacaaatgtgtaggttcgcagatt tgggtcattatgaacggagggaaagaattcaccgggaagctggttggattcgatgactac gtcaacatggtcttggagaacgtgacggagattgacccggcagagggaaatgtgcagctg cccaaaattctattgaacggcaacaacatctgcatgatggtgcccggaggagatgggcag acagttctggaggacgagtag

DBGET integrated database retrieval system