KEGG   Algihabitans albus: ABWI00_17065
Entry
ABWI00_17065      CDS       T10848                                 
Symbol
phoB
Name
(GenBank) phosphate regulon transcriptional regulator PhoB
  KO
K07657  two-component system, OmpR family, phosphate regulon response regulator PhoB
Organism
aalu  Algihabitans albus
Pathway
aalu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aalu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ABWI00_17065 (phoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:aalu02022]
    ABWI00_17065 (phoB)
Two-component system [BR:aalu02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   ABWI00_17065 (phoB)
SSDB
Motif
Pfam: Response_reg Trans_reg_C GlnR_1st GerE OKR_DC_1_N PDE8A_N DUF7669
Other DBs
NCBI-ProteinID: XHC49485
LinkDB
Position
3697860..3698558
AA seq 232 aa
MKPLILLVEDEAALVTLLRYNLEREGFRLVDARDGEEALVLAKEERPDLVLLDWMLPLMS
GLEVCRQLRRAAETRDVPIIILTARGEEADKVRGLDSGADDYITKPFSPAELVARMRAVL
RRAQPALANETLQFDDLEMDLAAHRVRRGPRDVHLGPTEFRLLRYLMQHPGRVFSREQLL
DAVWGRDVYVEPRTVDVHIRRLRKALNIEDETDLIRTVRSAGYALDRSQAAA
NT seq 699 nt   +upstreamnt  +downstreamnt
atgaagccgttgattttgcttgttgaggacgaggcggcgctggtcacgctgctgcgatac
aacctggagcgcgaaggcttccgtctggtcgatgcacgagatggtgaagaggccctggtg
ctggcgaaggaagagcggccggatctggtgctgctcgactggatgctgcccctgatgagc
ggcctcgaggtctgccgacagcttcgccgcgccgccgagacccgtgacgtgccgatcatc
atcctgacggcgcgcggcgaggaagcggacaaggttcgcggtctcgacagcggtgccgac
gactacatcaccaagcccttctcgccggcggagctggtggcgcgcatgcgagcggtgctt
cgtcgcgcgcagccggccctggccaatgaaaccttgcagttcgacgatctcgagatggat
ctggcggcacaccgggttcggcgcggaccgcgcgatgtgcacctgggtccgaccgagttc
cggcttttgcgctatctcatgcagcatcctggccgtgttttcagccgcgagcagttgctg
gatgccgtttggggccgcgacgtctatgtcgaaccccgcacggtcgatgttcacatccgc
cgtctgcgcaaggccctcaacatcgaggacgaaaccgacttgatccgcacggtgcggtcc
gccggttatgcgctggatcgttcccaagcggctgcctga

DBGET integrated database retrieval system