KEGG   Apteryx mantelli mantelli (North Island brown kiwi): 106483392
Entry
106483392         CDS       T04298                                 
Name
(RefSeq) dual specificity protein phosphatase CDC14B-like
  KO
K06639  cell division cycle 14 [EC:3.1.3.16 3.1.3.48]
Organism
aam  Apteryx mantelli mantelli (North Island brown kiwi)
Pathway
aam04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:aam00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106483392
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aam01009]
    106483392
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:aam03037]
    106483392
Enzymes [BR:aam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     106483392
    3.1.3.48  protein-tyrosine-phosphatase
     106483392
Protein phosphatases and associated proteins [BR:aam01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   CDC14
    106483392
Cilium and associated proteins [BR:aam03037]
 Other cilia and associated proteins
  Stereociliary proteins
   106483392
SSDB
Motif
Pfam: Tc-R-P PTP-SAK DSPc PTP-NADK PTPlike_phytase DSPn Y_phosphatase Y_phosphatase3 Y_phosphatase2 CDKN3
Other DBs
NCBI-GeneID: 106483392
NCBI-ProteinID: XP_013796744
LinkDB
Position
Un
AA seq 184 aa
MCYRDASFGTCSFHLTLLDCFHAINKALRYGFLDFNVFDVNEYEHYERAENGDFNWIIPN
KFIAFSGPHSRSKIENGYPHHAPEAYFPYFKKHKVTTIIRLNKKLYDAKRFTDAGFEHYD
LFFADGSTPSDTIVKTFLNICESAEGVIAIHCKAGLGRTGTLTACYIMKHYRMTAAXLDH
NNTS
NT seq 555 nt   +upstreamnt  +downstreamnt
atgtgttacagggatgcttcatttggtacttgcagttttcatctaacattgctggattgt
tttcatgcaataaacaaggctttgcggtatggtttcctggatttcaatgtgtttgatgta
aatgaatatgagcattatgagagagcagaaaatggagattttaactggataataccaaac
aaattcattgccttcagtggacctcattcaagaagtaaaattgaaaatggctatccccac
catgctccagaggcttatttcccgtacttcaagaaacataaggtcaccactataatacgc
ctcaacaaaaagctgtatgatgccaaacgatttacagatgctggatttgagcattatgac
ctcttctttgctgatggaagcacacctagtgatactatagttaaaacatttctaaatatt
tgtgaaagtgctgaaggtgttatagccattcattgcaaagctggtcttggacgaactggc
acacttacagcctgttatattatgaagcattaccggatgacagctgctnaattggaccac
aacaacacttcctga

DBGET integrated database retrieval system