Alcaligenes ammonioxydans: FE795_07740 Help Entry FE795_07740       CDS       T07763                                  Name (GenBank) monooxygenase   KO K16244   phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243] Organism aamm  Alcaligenes ammonioxydans Pathway aamm00361   Chlorocyclohexane and chlorobenzene degradation aamm00362   Benzoate degradation aamm00623   Toluene degradation aamm01100   Metabolic pathways aamm01120   Microbial metabolism in diverse environments aamm01220   Degradation of aromatic compounds Module aamm_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:aamm00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     FE795_07740    00361 Chlorocyclohexane and chlorobenzene degradation     FE795_07740    00623 Toluene degradation     FE795_07740 Enzymes [BR:aamm01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      FE795_07740     1.14.13.244  phenol 2-monooxygenase (NADH)      FE795_07740 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MmoB_DmpM Motif Other DBs NCBI-ProteinID:  QXX78915 LinkDB All DBs Position 1706792..1707064 Genome browser AA seq 90 aa AA seqDB search MTSKVYIGLQDNDMSRYIVEAIEEDNPDATVIYQPAMIRIECVGQLTVKRETVEEKYGQQ WDMQELHLNLITLGGNVDEDEDRLFLHWNS NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgacatccaaggtttatatcggcctgcaagacaacgacatgtcgcgctacatcgtcgag gccatcgaggaagacaacccggacgcgacggtgatttatcagccagccatgatccgtatt gagtgtgtgggtcagttgaccgtcaagcgcgagaccgtggaagaaaagtatgggcagcaa tgggacatgcaggagctgcatctgaatctgatcaccttgggtggcaacgtggatgaagat gaagaccgcttgtttttgcactggaacagctaa

DBGET integrated database retrieval system