Arvicola amphibius (Eurasian water vole): 119804923
Help
Entry
119804923 CDS
T08327
Symbol
Timm17b
Name
(RefSeq) mitochondrial import inner membrane translocase subunit Tim17-B
KO
K17795
mitochondrial import inner membrane translocase subunit TIM17
Organism
aamp
Arvicola amphibius (Eurasian water vole)
Brite
KEGG Orthology (KO) [BR:
aamp00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03029 Mitochondrial biogenesis [BR:
aamp03029
]
119804923 (Timm17b)
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
aamp02000
]
119804923 (Timm17b)
Mitochondrial biogenesis [BR:
aamp03029
]
Mitochondrial protein import machinery
Inner mambrane
TIM23 complex
119804923 (Timm17b)
Transporters [BR:
aamp02000
]
Other transporters
Primary active transporters [TC:
3
]
119804923 (Timm17b)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Tim17
Motif
Other DBs
NCBI-GeneID:
119804923
NCBI-ProteinID:
XP_038172633
LinkDB
All DBs
Position
X:complement(16426188..16434550)
Genome browser
AA seq
172 aa
AA seq
DB search
MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRFRGSVNAVRIRAP
QIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGG
ILLALIEGVGILLTRYTAQQFRNAPPFLEDPNQLTPKEGAPAPGYPNYQQYH
NT seq
519 nt
NT seq
+upstream
nt +downstream
nt
atggaggagtacgctcgcgaaccttgcccatggcggattgtggatgattgcggtggagcc
ttcactatgggtgtcattggtggtggagtcttccaggctatcaagggctttcgcaatgcc
cctgttggaatacgacaccgcttcagaggtagtgtcaatgctgtgaggattcgagcaccc
cagattggaggtagctttgcagtgtggggaggcctgttttccaccattgactgtggcctt
gtacggctgaggggcaaggaagacccctggaactccatcaccagtggagcgttgactgga
gcagtgctggctgcacgcagtggtcctctggctatggtgggctctgcgatgatggggggc
atcctgttggccctcatcgagggtgttggtatccttctcactcgctataccgcccagcag
ttccgcaatgcacccccattcttggaggaccccaaccagctaactcctaaagaaggagct
ccggccccaggttatcccaactaccagcagtaccactga
DBGET
integrated database retrieval system