KEGG   Arvicola amphibius (Eurasian water vole): 119814535
Entry
119814535         CDS       T08327                                 
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1-like
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
aamp  Arvicola amphibius (Eurasian water vole)
Pathway
aamp04010  MAPK signaling pathway
aamp04014  Ras signaling pathway
aamp04015  Rap1 signaling pathway
aamp04024  cAMP signaling pathway
aamp04062  Chemokine signaling pathway
aamp04071  Sphingolipid signaling pathway
aamp04145  Phagosome
aamp04148  Efferocytosis
aamp04151  PI3K-Akt signaling pathway
aamp04310  Wnt signaling pathway
aamp04360  Axon guidance
aamp04370  VEGF signaling pathway
aamp04380  Osteoclast differentiation
aamp04510  Focal adhesion
aamp04517  IgSF CAM signaling
aamp04518  Integrin signaling
aamp04520  Adherens junction
aamp04530  Tight junction
aamp04613  Neutrophil extracellular trap formation
aamp04620  Toll-like receptor signaling pathway
aamp04650  Natural killer cell mediated cytotoxicity
aamp04662  B cell receptor signaling pathway
aamp04664  Fc epsilon RI signaling pathway
aamp04666  Fc gamma R-mediated phagocytosis
aamp04670  Leukocyte transendothelial migration
aamp04722  Neurotrophin signaling pathway
aamp04810  Regulation of actin cytoskeleton
aamp04932  Non-alcoholic fatty liver disease
aamp04933  AGE-RAGE signaling pathway in diabetic complications
aamp04972  Pancreatic secretion
aamp05014  Amyotrophic lateral sclerosis
aamp05020  Prion disease
aamp05022  Pathways of neurodegeneration - multiple diseases
aamp05100  Bacterial invasion of epithelial cells
aamp05132  Salmonella infection
aamp05135  Yersinia infection
aamp05163  Human cytomegalovirus infection
aamp05167  Kaposi sarcoma-associated herpesvirus infection
aamp05169  Epstein-Barr virus infection
aamp05170  Human immunodeficiency virus 1 infection
aamp05200  Pathways in cancer
aamp05203  Viral carcinogenesis
aamp05205  Proteoglycans in cancer
aamp05208  Chemical carcinogenesis - reactive oxygen species
aamp05210  Colorectal cancer
aamp05211  Renal cell carcinoma
aamp05212  Pancreatic cancer
aamp05231  Choline metabolism in cancer
aamp05415  Diabetic cardiomyopathy
aamp05416  Viral myocarditis
aamp05417  Lipid and atherosclerosis
aamp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aamp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    119814535
   04014 Ras signaling pathway
    119814535
   04015 Rap1 signaling pathway
    119814535
   04310 Wnt signaling pathway
    119814535
   04370 VEGF signaling pathway
    119814535
   04071 Sphingolipid signaling pathway
    119814535
   04024 cAMP signaling pathway
    119814535
   04151 PI3K-Akt signaling pathway
    119814535
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    119814535
   04518 Integrin signaling
    119814535
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    119814535
   04148 Efferocytosis
    119814535
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    119814535
   04520 Adherens junction
    119814535
   04530 Tight junction
    119814535
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    119814535
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    119814535
   04620 Toll-like receptor signaling pathway
    119814535
   04650 Natural killer cell mediated cytotoxicity
    119814535
   04662 B cell receptor signaling pathway
    119814535
   04664 Fc epsilon RI signaling pathway
    119814535
   04666 Fc gamma R-mediated phagocytosis
    119814535
   04670 Leukocyte transendothelial migration
    119814535
   04062 Chemokine signaling pathway
    119814535
  09154 Digestive system
   04972 Pancreatic secretion
    119814535
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    119814535
  09158 Development and regeneration
   04360 Axon guidance
    119814535
   04380 Osteoclast differentiation
    119814535
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    119814535
   05205 Proteoglycans in cancer
    119814535
   05208 Chemical carcinogenesis - reactive oxygen species
    119814535
   05203 Viral carcinogenesis
    119814535
   05231 Choline metabolism in cancer
    119814535
  09162 Cancer: specific types
   05210 Colorectal cancer
    119814535
   05212 Pancreatic cancer
    119814535
   05211 Renal cell carcinoma
    119814535
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    119814535
   05163 Human cytomegalovirus infection
    119814535
   05167 Kaposi sarcoma-associated herpesvirus infection
    119814535
   05169 Epstein-Barr virus infection
    119814535
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    119814535
   05135 Yersinia infection
    119814535
   05100 Bacterial invasion of epithelial cells
    119814535
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    119814535
   05020 Prion disease
    119814535
   05022 Pathways of neurodegeneration - multiple diseases
    119814535
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    119814535
   05418 Fluid shear stress and atherosclerosis
    119814535
   05415 Diabetic cardiomyopathy
    119814535
   05416 Viral myocarditis
    119814535
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    119814535
   04933 AGE-RAGE signaling pathway in diabetic complications
    119814535
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aamp04131]
    119814535
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aamp04147]
    119814535
   04031 GTP-binding proteins [BR:aamp04031]
    119814535
Membrane trafficking [BR:aamp04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    119814535
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    119814535
  Macropinocytosis
   Ras GTPases
    119814535
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    119814535
Exosome [BR:aamp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   119814535
  Exosomal proteins of other body fluids (saliva and urine)
   119814535
  Exosomal proteins of colorectal cancer cells
   119814535
  Exosomal proteins of bladder cancer cells
   119814535
GTP-binding proteins [BR:aamp04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    119814535
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU CagD
Other DBs
NCBI-GeneID: 119814535
NCBI-ProteinID: XP_038186305
LinkDB
Position
5:complement(147021223..147022252)
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLVSYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSCPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgttggtaaaacctgcctgctg
gtcagttacacgaccaatgcctttcctggagagtacatccccaccgtctttgacaactat
tctgccaatgttatggtagatggaaagccagtgaatctgggcttatgggacacagctgga
caagaagattatgacagattgcgtcccctctcctgtccgcaaacagacgtgttcttaatt
tgcttttcccttgtgagtcctgcatcatttgaaaatgtccgtgcaaagtggtatcctgaa
gtgcgacaccactgtcccaacactcccatcatcctagtggggacgaagcttgatcttagg
gatgataaggacacgattgagaagctgaaggagaagaaactgacccccatcacctacccg
caggggctcgccatggcaaaggagattggtgctgtcaaatacctggagtgctcagcgctc
acacagcgaggcctcaagacagtgtttgatgaagctatccgagcggttctctgtccacct
cctgtcaagaagaggaagagaaaatgcctgttgttgtaa

DBGET integrated database retrieval system