KEGG   Arvicola amphibius (Eurasian water vole): 119817552
Entry
119817552         CDS       T08327                                 
Name
(RefSeq) calmodulin-4-like
  KO
K02183  calmodulin
Organism
aamp  Arvicola amphibius (Eurasian water vole)
Pathway
aamp04014  Ras signaling pathway
aamp04015  Rap1 signaling pathway
aamp04020  Calcium signaling pathway
aamp04022  cGMP-PKG signaling pathway
aamp04024  cAMP signaling pathway
aamp04070  Phosphatidylinositol signaling system
aamp04114  Oocyte meiosis
aamp04218  Cellular senescence
aamp04261  Adrenergic signaling in cardiomyocytes
aamp04270  Vascular smooth muscle contraction
aamp04371  Apelin signaling pathway
aamp04625  C-type lectin receptor signaling pathway
aamp04713  Circadian entrainment
aamp04720  Long-term potentiation
aamp04722  Neurotrophin signaling pathway
aamp04728  Dopaminergic synapse
aamp04740  Olfactory transduction
aamp04744  Phototransduction
aamp04750  Inflammatory mediator regulation of TRP channels
aamp04910  Insulin signaling pathway
aamp04912  GnRH signaling pathway
aamp04915  Estrogen signaling pathway
aamp04916  Melanogenesis
aamp04921  Oxytocin signaling pathway
aamp04922  Glucagon signaling pathway
aamp04924  Renin secretion
aamp04925  Aldosterone synthesis and secretion
aamp04970  Salivary secretion
aamp04971  Gastric acid secretion
aamp05010  Alzheimer disease
aamp05012  Parkinson disease
aamp05022  Pathways of neurodegeneration - multiple diseases
aamp05031  Amphetamine addiction
aamp05034  Alcoholism
aamp05133  Pertussis
aamp05152  Tuberculosis
aamp05163  Human cytomegalovirus infection
aamp05167  Kaposi sarcoma-associated herpesvirus infection
aamp05170  Human immunodeficiency virus 1 infection
aamp05200  Pathways in cancer
aamp05214  Glioma
aamp05417  Lipid and atherosclerosis
aamp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aamp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    119817552
   04015 Rap1 signaling pathway
    119817552
   04371 Apelin signaling pathway
    119817552
   04020 Calcium signaling pathway
    119817552
   04070 Phosphatidylinositol signaling system
    119817552
   04024 cAMP signaling pathway
    119817552
   04022 cGMP-PKG signaling pathway
    119817552
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    119817552
   04218 Cellular senescence
    119817552
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    119817552
  09152 Endocrine system
   04910 Insulin signaling pathway
    119817552
   04922 Glucagon signaling pathway
    119817552
   04912 GnRH signaling pathway
    119817552
   04915 Estrogen signaling pathway
    119817552
   04921 Oxytocin signaling pathway
    119817552
   04916 Melanogenesis
    119817552
   04924 Renin secretion
    119817552
   04925 Aldosterone synthesis and secretion
    119817552
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    119817552
   04270 Vascular smooth muscle contraction
    119817552
  09154 Digestive system
   04970 Salivary secretion
    119817552
   04971 Gastric acid secretion
    119817552
  09156 Nervous system
   04728 Dopaminergic synapse
    119817552
   04720 Long-term potentiation
    119817552
   04722 Neurotrophin signaling pathway
    119817552
  09157 Sensory system
   04744 Phototransduction
    119817552
   04740 Olfactory transduction
    119817552
   04750 Inflammatory mediator regulation of TRP channels
    119817552
  09159 Environmental adaptation
   04713 Circadian entrainment
    119817552
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    119817552
  09162 Cancer: specific types
   05214 Glioma
    119817552
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    119817552
   05163 Human cytomegalovirus infection
    119817552
   05167 Kaposi sarcoma-associated herpesvirus infection
    119817552
  09171 Infectious disease: bacterial
   05133 Pertussis
    119817552
   05152 Tuberculosis
    119817552
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    119817552
   05012 Parkinson disease
    119817552
   05022 Pathways of neurodegeneration - multiple diseases
    119817552
  09165 Substance dependence
   05031 Amphetamine addiction
    119817552
   05034 Alcoholism
    119817552
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    119817552
   05418 Fluid shear stress and atherosclerosis
    119817552
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aamp01009]
    119817552
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aamp04131]
    119817552
   03036 Chromosome and associated proteins [BR:aamp03036]
    119817552
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aamp04147]
    119817552
Protein phosphatases and associated proteins [BR:aamp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     119817552
Membrane trafficking [BR:aamp04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    119817552
Chromosome and associated proteins [BR:aamp03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     119817552
Exosome [BR:aamp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   119817552
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 AIF-1 EF-hand_9 EH EF_EFCAB10_C SPARC_Ca_bdg DUF2267 TerB DUF5580_M Caleosin ThsA_Macro EF-hand_11 Dockerin_1 SurA_N_3 SurA_N_2 Phage_TAC_13 EFhand_Ca_insen
Other DBs
NCBI-GeneID: 119817552
NCBI-ProteinID: XP_038190795
LinkDB
Position
6:108177688..108236375
AA seq 148 aa
MSHGFPKEQVEEFHAAFDRFDKNKDGHISVQELGDVMKQLGKNLSEEELKALISRVDTDN
DGTISFDEFLAAMAKYKRGSSEQEMRAVFSVFDKDGDGHITVDELKQAMTQLGEEISQEE
LDGMIREADVDKDGKVDYNEFVRMLKEK
NT seq 447 nt   +upstreamnt  +downstreamnt
atgtctcacgggtttcctaaagagcaggtggaagagttccacgcagcctttgataggttt
gacaagaataaggacggccacatcagtgtccaggaactgggcgatgtgatgaagcagctc
ggcaagaacctctcagaggaagagctgaaggcactcatctccagggtggacacagacaat
gatggcaccatcagctttgacgaattcttggcagccatggccaagtacaagagagggagc
tccgagcaggagatgcgggctgtgttcagtgtctttgacaaagatggtgatgggcacatc
acagtggacgagctcaagcaggccatgacgcagctgggagaggagatttcacaggaggag
ctggacggcatgatccgtgaggctgatgtggacaaggatgggaaggtggactataacgag
tttgtgcgcatgctcaaggagaagtga

DBGET integrated database retrieval system