Arvicola amphibius (Eurasian water vole): 119817750
Help
Entry
119817750 CDS
T08327
Symbol
Fbxo2
Name
(RefSeq) F-box only protein 2
KO
K10099
F-box protein 2
Organism
aamp
Arvicola amphibius (Eurasian water vole)
Pathway
aamp04120
Ubiquitin mediated proteolysis
aamp04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
aamp00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
119817750 (Fbxo2)
04120 Ubiquitin mediated proteolysis
119817750 (Fbxo2)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04121 Ubiquitin system [BR:
aamp04121
]
119817750 (Fbxo2)
09183 Protein families: signaling and cellular processes
04091 Lectins [BR:
aamp04091
]
119817750 (Fbxo2)
Ubiquitin system [BR:
aamp04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Target recognizing subunit (F-box)
119817750 (Fbxo2)
Lectins [BR:
aamp04091
]
F-box lectins
119817750 (Fbxo2)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
FBA
F-box-like
F-box
PAH
Motif
Other DBs
NCBI-GeneID:
119817750
NCBI-ProteinID:
XP_038191085
LinkDB
All DBs
Position
6:complement(8181997..8187527)
Genome browser
AA seq
299 aa
AA seq
DB search
MDGDGDPENGSHPEEVSPEEQPEEAGAEASAEEEQPREEEEEEEEEAEAVEYLAQLPEPL
LLRVLAELPASELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEGCADDERDHWQQFY
FLSKRRRNLLRNPCGEEDLEGWCDVEHGGDGWRVEELPGDSGVEFTQDDSVKKYFASSFE
WCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRTDAGSLYELTVRLLSEHEDVLAEF
NTGQVAVPEDGSWMEISHTFTDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
NT seq
900 nt
NT seq
+upstream
nt +downstream
nt
atggatggagatggtgatccagagaatgggagccaccccgaagaggtgagcccagaggag
cagccagaggaggcgggagccgaggcgagtgcagaggaggagcagccccgggaggaggag
gaggaggaggaggaagaggccgaggcagtcgagtacctggcccagttgccggagccgctg
ctgctgcgcgtgctggccgagctgccagcctcggagctggtgcaggcctgccgcctggtg
tgcctgcgctggaaggagctggtggacggcgccccactgtggctgctcaagtgccagcag
gaggggctggtgcccgagggttgcgcagatgatgagcgggaccactggcaacagttctac
tttttgagcaagaggaggcgcaacctgctgcgtaatccgtgcggggaagaggacttggag
ggctggtgtgacgtggagcacggtggggacggctggagggtggaggaactgcctggagac
agtggggtggaatttacccaagatgacagcgttaagaagtacttcgcctcctccttcgag
tggtgtcgcaaagcgcaggtcattgatctgcaggccgagggctactgggaggagctgctg
gacaccacccagcccgccatcgtggtgaaggactggtactcgggccgcacggatgccggc
agcctgtatgagctcaccgtgaggctgctgtcggagcacgaagatgtgctggcggagttc
aacaccgggcaggtggcagtgccggaggacggcagctggatggagatctcccacaccttc
accgactacgggccaggcgtccgctttgtccgcttcgagcacggagggcaggactcggtc
tactggaagggctggttcggggcccgggtgaccaacagtagcgtgtgggtggaaccctga
DBGET
integrated database retrieval system