KEGG   Anoxybacteroides amylolyticum: GFC30_1149
Entry
GFC30_1149        CDS       T04397                                 
Name
(GenBank) binding--dependent transport system inner membrane component family protein
  KO
K15582  oligopeptide transport system permease protein
Organism
aamy  Anoxybacteroides amylolyticum
Pathway
aamy01501  beta-Lactam resistance
aamy02010  ABC transporters
aamy02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:aamy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    GFC30_1149
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GFC30_1149
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    GFC30_1149
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aamy02000]
    GFC30_1149
Transporters [BR:aamy02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Oligopeptide transporter
    GFC30_1149
SSDB
Motif
Pfam: BPD_transp_1 OppC_N
Other DBs
NCBI-ProteinID: ANB59290
UniProt: A0A167T179
LinkDB
Position
1102533..1103450
AA seq 305 aa
MQQISKEMFQPASVDLSEAEKISKPSLSFWKDVSIRFRKNKLAMFGLVLLALLLFMAIFG
PHMTKYDYSTNDLMNTNKPPSAEHWFGTDDLGRDIFTRTWYGARISLFIGLAAALIDLFI
GVLWGGIAGFRGGRTDDVMMRIADILWAVPYLLLVILLMVVLGQGLGTMILAMTITGWIN
MARIVRGQVLQLKSQEYVLAAQTLGANTSRIMFKHLIPNAMGPILVTLTLSIPSAIFTEA
FLSYLGLGVPQPLASWGTMASEGVQALQYYPWRLFFPATFICLTIFAFNVVGDGLRDALD
PRLRK
NT seq 918 nt   +upstreamnt  +downstreamnt
atgcagcaaatttcaaaagaaatgtttcaacctgcatcggttgatttaagtgaggcggaa
aaaatttcgaagccgagtttgtccttttggaaagacgtttcgattcgttttcgcaaaaat
aaattagcaatgtttggtctagtattattagctttgttattatttatggcgattttcggt
ccgcatatgacgaaatacgattactcgacaaatgacttaatgaatacaaacaaaccacct
tcagcagaacattggtttggaacggacgaccttggtcgtgacattttcactcgcacatgg
tatggggcgcgcatttcgttatttatcgggctagcggcagcgttaatcgatttattcatc
ggtgtcctttggggaggaattgctggattccgcggtggaagaacagacgacgtgatgatg
cggattgctgatattttatgggcggttccttatttgctgttagttattttattaatggtc
gtgttagggcaagggttaggtacgatgattttagcgatgacgattaccggttggattaac
atggcgcggattgtacgcggacaagtgctgcagttgaaaagccaagagtacgtgttagca
gcgcaaacgttaggggcaaacacgtcaagaattatgtttaaacatttaattccgaacgca
atgggaccaattcttgtcacattgacattatcgattccatccgctatttttacggaagca
tttttaagctacttaggtcttggggtaccacaacctttagcgagctggggaacgatggct
tctgaaggggtacaagcgttgcaatattatccatggcgtctattcttcccggctacgttc
atttgcttaacgatttttgcgtttaacgttgtcggtgacgggttgcgtgatgcattagat
ccgagattgcgtaagtaa

DBGET integrated database retrieval system