Anguilla anguilla (European eel): 118206777 Help Entry 118206777         CDS       T07545                                  Symbol ccl27a Name (RefSeq) C-C motif chemokine 27a   KO K05513   C-C motif chemokine 28 Organism aang  Anguilla anguilla (European eel) Pathway aang04060   Cytokine-cytokine receptor interaction aang04672   Intestinal immune network for IgA production Brite KEGG Orthology (KO) [BR:aang00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     118206777 (ccl27a)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     118206777 (ccl27a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aang04052]     118206777 (ccl27a) Cytokines and neuropeptides [BR:aang04052]  Cytokines   Chemokines    118206777 (ccl27a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  118206777 NCBI-ProteinID:  XP_035235733 LinkDB All DBs Position 10:complement(42994099..42997131) Genome browser AA seq 101 aa AA seqDB search MALSIQALLLALSLLLWVFTLTCEGAMPKCCLYTDRSITPRLLRRAEKIEVQSSGGFCDI NALIIHVKGKKFCAHLPKKEILTKILKRRSGKKRMKSRLGI NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggcactcagcatccaagcattgctcctggccttgtccctgctcctctgggtcttcaca ctcacctgtgaaggagccatgccaaaatgctgcctctacacggatagatccatcacgcca aggttactgcggagagcggagaagatcgaggttcagagcagtggcgggttttgcgacatc aacgctctaataatacacgtgaaaggaaagaagttctgtgcgcacctgccaaagaaggaa atcctgacgaaaattctgaaacgcaggagtggcaaaaagaggatgaagtctcgtttgggc atttaa

DBGET integrated database retrieval system