Anguilla anguilla (European eel): 118207699 Help Entry 118207699         CDS       T07545                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism aang  Anguilla anguilla (European eel) Pathway aang04137   Mitophagy - animal aang04140   Autophagy - animal aang04144   Endocytosis aang04145   Phagosome aang04148   Efferocytosis aang05132   Salmonella infection Brite KEGG Orthology (KO) [BR:aang00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     118207699    04145 Phagosome     118207699    04140 Autophagy - animal     118207699    04137 Mitophagy - animal     118207699    04148 Efferocytosis     118207699  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118207699  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aang04131]     118207699   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aang04147]     118207699    04031 GTP-binding proteins [BR:aang04031]     118207699 Membrane trafficking [BR:aang04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     118207699 Exosome [BR:aang04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118207699   Exosomal proteins of other body fluids (saliva and urine)    118207699   Exosomal proteins of colorectal cancer cells    118207699   Exosomal proteins of bladder cancer cells    118207699 GTP-binding proteins [BR:aang04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     118207699 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  118207699 NCBI-ProteinID:  XP_035237430 LinkDB All DBs Position 11:complement(21370081..21384877) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRGKPSAETCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacgtccaggaagaaagttctcctcaaggttattatcctgggagactctggagttggg aagacttctctgatgaaccagtatgtgaataagaagtttagtaatcagtacaaagccaca ataggagccgacttcctgacaaaagaggtgatggtggacgacagacttgtcacaatgcag atctgggacacggcagggcaggagcgcttccagtccctgggtgtggcgttctaccgcggt gcggactgctgcgtgctcgtgttcgacgtgaccgcgcccaacaccttcaagaccctggac agctggcgggacgagttcctgatccaggccagcccccgtgaccccgagaacttccccttc gtggtgctaggcaacaaaatcgacctggagaacagacaggtaacgaccaagcgtgcgcag gcctggtgccagagtaagaacaacatcccgtactttgagactagcgccaaagaggccatc aacgtggagcaggccttccagaccatcgcacgcaacgccctgaagcaggagacagaagta gagctgtacaatgagttcccagagccaatcaaactggacaagaatgaccgaggcaagcca tcggcagagacctgcagctgctga

DBGET integrated database retrieval system