Anguilla anguilla (European eel): 118212633 Help Entry 118212633         CDS       T07545                                  Symbol s100a10b Name (RefSeq) protein S100-A10b   KO K17274   protein S100-A10 Organism aang  Anguilla anguilla (European eel) Pathway aang04382   Cornified envelope formation aang05132   Salmonella infection Brite KEGG Orthology (KO) [BR:aang00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     118212633 (s100a10b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118212633 (s100a10b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aang04147]     118212633 (s100a10b) Exosome [BR:aang04147]  Exosomal proteins   Exosomal proteins of microglial cells    118212633 (s100a10b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 EH Motif Other DBs NCBI-GeneID:  118212633 NCBI-ProteinID:  XP_035246640 LinkDB All DBs Position 1:69713077..69716085 Genome browser AA seq 101 aa AA seqDB search MPSELERAMEMLISVFHRYAAKEGNSNSLNRSELKTLMESELSGFLKSQKDPDAVGSIMK SLDDNRDGEVDFKEFVSLVVGLSIACEQCYQMHLLKQKGKK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgccttcagaactggaacgcgccatggagatgctgatcagtgtctttcaccgctacgcc gccaaggagggcaacagcaactccctgaaccgctccgagctcaagaccctgatggagagc gaactgtctgggtttctcaaatcccagaaggaccctgatgcggtgggcagtatcatgaaa agcctggatgacaaccgagatggggaggtggacttcaaggagtttgtgtccctggtggtg gggctctccatcgcctgtgagcagtgctaccagatgcacctgctgaagcagaagggcaag aagtga

DBGET integrated database retrieval system