Anguilla anguilla (European eel): 118213889 Help Entry 118213889         CDS       T07545                                  Symbol prlh Name (RefSeq) prolactin-releasing peptide   KO K05269   prolactin-releasing peptide Organism aang  Anguilla anguilla (European eel) Pathway aang04080   Neuroactive ligand-receptor interaction aang04081   Hormone signaling Brite KEGG Orthology (KO) [BR:aang00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     118213889 (prlh)    04081 Hormone signaling     118213889 (prlh)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aang04052]     118213889 (prlh) Cytokines and neuropeptides [BR:aang04052]  Neuropeptides   GPCR binding    118213889 (prlh) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Prolactin_RP Motif Other DBs NCBI-GeneID:  118213889 NCBI-ProteinID:  XP_035248999 LinkDB All DBs Position 15:complement(23443131..23446845) Genome browser AA seq 85 aa AA seqDB search MRVWAFLCTLMLLMSLVLSKSHGRYPQRSMEVRNPDIDASWYTGRGIRPLGRFGRQEAGV NRGSKHPVRHLCIPVAAEDDSNDNQ NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagagtttgggcctttctgtgtaccctcatgctgctgatgtccctggtgctgtccaaa tcgcatggcaggtacccacagcggtccatggaggtccgaaatccagacatcgatgcttcc tggtacacggggcggggcatccggccgctggggcgctttggccggcaggaggccggggtc aacagagggtcaaagcaccccgtccgccatctgtgcattcccgtcgcggctgaagacgac tcaaacgataaccagtga

DBGET integrated database retrieval system