Anguilla anguilla (European eel): 118217335 Help Entry 118217335         CDS       T07545                                  Symbol rras Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism aang  Anguilla anguilla (European eel) Pathway aang04010   MAPK signaling pathway aang04137   Mitophagy - animal aang04140   Autophagy - animal aang04218   Cellular senescence aang04371   Apelin signaling pathway aang04625   C-type lectin receptor signaling pathway aang04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:aang00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118217335 (rras)    04371 Apelin signaling pathway     118217335 (rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     118217335 (rras)    04137 Mitophagy - animal     118217335 (rras)   09143 Cell growth and death    04218 Cellular senescence     118217335 (rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     118217335 (rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     118217335 (rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aang04147]     118217335 (rras)    04031 GTP-binding proteins [BR:aang04031]     118217335 (rras) Exosome [BR:aang04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    118217335 (rras)   Exosomal proteins of bladder cancer cells    118217335 (rras) GTP-binding proteins [BR:aang04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     118217335 (rras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 HTH_NOL4_2nd MMR_HSR1_Xtn Motif Other DBs NCBI-GeneID:  118217335 NCBI-ProteinID:  XP_035255142 LinkDB All DBs Position 17:complement(8145347..8151300) Genome browser AA seq 198 aa AA seqDB search MSTEEERFKIVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICSVDGKQTRLDIL DTAGQEEFGAMREQYMRSGEGFLLAFALNDRGSYNEIQKFHTQILRVKDRDDYPMVLVGN KVDLEPLRQIPKEEAQAFARENRIHYMESSAKSRYNVDEAFLQVVRAIRRFKETESPPIP SNQTRKSKNASGCPCTLL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgtcgacagaagaggaaaggtttaagatcgtagtggtaggcggaggaggtgtgggaaag agtgctttgaccattcagttcattcagtcatacttcgtatctgactatgaccccaccatt gaagactcctacacaaagatctgctcggtggacgggaaacagacgcgactggatatcctg gacacggcggggcaggaggagtttggggcgatgcgggagcagtacatgcgctcaggagaa ggcttcctgctggcgttcgcgctgaacgacagagggagttacaatgagatccagaagttc cacacgcagattctgagagtgaaggacagggatgactaccccatggttctggtcggcaac aaagtggaccttgagccgttaagacagatacccaaggaggaagcccaggctttcgccaga gagaatcggatccattacatggagtcttcagccaagagccggtacaacgtggacgaggcc ttcctgcaggtcgtgcgggcgatcaggaggttcaaagagacggagagcccccccatcccc tccaaccagacccgcaagtccaagaacgccagcggctgcccctgcaccttactgtaa

DBGET integrated database retrieval system