Anguilla anguilla (European eel): 118219656 Help Entry 118219656         CDS       T07545                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism aang  Anguilla anguilla (European eel) Pathway aang03082   ATP-dependent chromatin remodeling aang04217   Necroptosis Brite KEGG Orthology (KO) [BR:aang00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     118219656  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     118219656  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aang03036]     118219656   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aang04147]     118219656 Chromosome and associated proteins [BR:aang03036]  Eukaryotic type   Nucleosome assembly factors    Histones     118219656 Exosome [BR:aang04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118219656 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  118219656 NCBI-ProteinID:  XP_035258886 LinkDB All DBs Position 2:72211589..72212804 Genome browser AA seq 128 aa AA seqDB search MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKAVKAK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgagtggacggggcaagactggcggtaaggcgagagcgaaagcaaagactcgttcgtcg agggcgggactgcagtttccagtaggtcgcgttcaccgattgctacgtaaaggaaactat gctgagcgtgttggtgctggcgctccagtatacttagctgccgtgctggagtatctaact gctgagattttggagctggctggtaatgcggcccgcgacaacaagaaaactcgcatcatt cccagacatctgcagctggcagtgcgtaatgacgaagagctgaacaaactgcttggaggc gttactatcgcccagggcggagtactgcccaacatccaagctgttctgctccccaagaaa accgaaaaagcagtgaaggcaaagtaa

DBGET integrated database retrieval system