Anguilla anguilla (European eel): 118220283 Help Entry 118220283         CDS       T07545                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism aang  Anguilla anguilla (European eel) Pathway aang04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:aang00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     118220283  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:aang04121]     118220283    03400 DNA repair and recombination proteins [BR:aang03400]     118220283 Ubiquitin system [BR:aang04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      118220283    Cul5 complex      118220283 DNA repair and recombination proteins [BR:aang03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      118220283 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  118220283 NCBI-ProteinID:  XP_035259975 LinkDB All DBs Position 2:39852131..39857154 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRAPEEQRLFKDDQLLEDNKTLGDC GFTNQTARPQAPATVGLAFRINDEVFEQLRVEPFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtgtttctcatgattcggcgccacaaaacaaccatcttcactgatgccaaggag tccaccactgtttatgagctgaagcgcattgtggaagggatcctgaaaagggcaccagag gagcagagactcttcaaggatgatcagttgttagaggacaataagactcttggagactgt gggttcactaatcagacagcaagacctcaggccccggccactgttggcctagcttttcgc atcaatgatgaggtgtttgagcaactgcgggtagaaccattctccagcccccctgagctc ccagatgtaatgaagccccaggactctggcagcactgctaacgagcaggccgtccagtga

DBGET integrated database retrieval system