Anguilla anguilla (European eel): 118225521 Help Entry 118225521         CDS       T07545                                  Symbol rheb Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism aang  Anguilla anguilla (European eel) Pathway aang04140   Autophagy - animal aang04150   mTOR signaling pathway aang04218   Cellular senescence aang04910   Insulin signaling pathway aang05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:aang00001]  09130 Environmental Information Processing   09132 Signal transduction    04150 mTOR signaling pathway     118225521 (rheb)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     118225521 (rheb)   09143 Cell growth and death    04218 Cellular senescence     118225521 (rheb)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     118225521 (rheb)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     118225521 (rheb)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:aang04031]     118225521 (rheb) GTP-binding proteins [BR:aang04031]  Small (monomeric) G-proteins   Ras Family    Rheb     118225521 (rheb) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase YebF ParE_toxin RhoGAP_pG1_pG2 Reovirus_M2 AAA_14 Motif Other DBs NCBI-GeneID:  118225521 NCBI-ProteinID:  XP_035269897 LinkDB All DBs Position 4:complement(18149984..18193110) Genome browser AA seq 184 aa AA seqDB search MPQPKSRKIAVLGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKMITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSNKSFEVVKVIHEKLLDMVGKVQVPIMLVGNK KDLHMERVISCEEGKALADSWNAAFMESSAKENQTAVEVFKRIILEAEKIDGGAPQGRTS CSLM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagccgaaatcccgtaagatcgccgtcctgggatacagatccgtgggaaagtcc tccttaacaatacagtttgtggaaggccagtttgtcgactcatatgatccaaccatagaa aacacatttacaaaaatgatcacagtaaatggacaggagtaccatctgcagttagtagac acagcagggcaggacgaatactcaattttcccccagacatactccatagacatcaacggc tacattctggtgtattcagtcacgtcaaacaaaagttttgaagtagtaaaagttatccat gaaaaattgttggatatggtgggaaaagttcaagtgcccattatgttggtcggaaacaag aaagacctacacatggaacgggtaatcagttgtgaagaggggaaggccttggcagattcc tggaatgcagcgtttatggagtcctccgctaaagagaaccagaccgcggtggaggtgttc aagaggataatcctggaggcggagaagattgatgggggcgctccgcaggggaggacgtcc tgctccctgatgtag

DBGET integrated database retrieval system