Anguilla anguilla (European eel): 118227140 Help Entry 118227140         CDS       T07545                                  Name (RefSeq) thioredoxin-like   KO K03671   thioredoxin Organism aang  Anguilla anguilla (European eel) Pathway aang04621   NOD-like receptor signaling pathway aang05132   Salmonella infection Brite KEGG Orthology (KO) [BR:aang00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     118227140  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118227140  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:aang03110]     118227140 Chaperones and folding catalysts [BR:aang03110]  Protein folding catalysts   Protein disulfide isomerase    118227140 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin AhpC-TSA Thioredoxin_8 Redoxin OST3_OST6 Thioredoxin_2 Thioredoxin_9 Thioredoxin_7 DIM1 Motif Other DBs NCBI-GeneID:  118227140 NCBI-ProteinID:  XP_035273193 LinkDB All DBs Position 5:65801050..65805703 Genome browser AA seq 105 aa AA seqDB search MLIIIEDQEGFEEALVDAGDKLVVVDFTATWCGPCQSIAPFFKELSDKYPDVVFLKVDVD DAADVASFCDIKCMPTFQFYKNSEKVDEFAGSNQGKLEEMICSKK NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgcttatcataatcgaagatcaggagggttttgaggaggccctggttgatgctggagac aagctggtggtggtcgacttcacagcgacatggtgcgggccctgccagagcatcgccccc tttttcaaagagctgtctgataagtaccctgacgtggtgtttctgaaggttgatgtggat gacgcagcggacgtcgccagcttctgtgacatcaaatgcatgcccacattccagttctac aaaaatagcgaaaaggtggatgaatttgctgggtcaaaccaaggcaagctggaagaaatg atttgcagcaaaaaatga

DBGET integrated database retrieval system