Anguilla anguilla (European eel): 118227146 Help Entry 118227146         CDS       T07545                                  Name (RefSeq) permeability factor 2-like   KO K10030   interleukin 8 Organism aang  Anguilla anguilla (European eel) Pathway aang04060   Cytokine-cytokine receptor interaction aang04218   Cellular senescence aang04620   Toll-like receptor signaling pathway aang04621   NOD-like receptor signaling pathway aang04622   RIG-I-like receptor signaling pathway aang05132   Salmonella infection Brite KEGG Orthology (KO) [BR:aang00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     118227146  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     118227146  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     118227146    04621 NOD-like receptor signaling pathway     118227146    04622 RIG-I-like receptor signaling pathway     118227146  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118227146  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aang04052]     118227146    00536 Glycosaminoglycan binding proteins [BR:aang00536]     118227146 Cytokines and neuropeptides [BR:aang04052]  Cytokines   Chemokines    118227146 Glycosaminoglycan binding proteins [BR:aang00536]  Heparan sulfate / Heparin   Chemokines    118227146 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  118227146 NCBI-ProteinID:  XP_035273202 LinkDB All DBs Position 5 Genome browser AA seq 97 aa AA seqDB search MKITITAAICLVFLAALSTEGMSVRGIGVDLRCRCIETESRRMAKLIQSVELFPPSAHCK DTEIIATLKGTGQQICLDTTAPWVKKVIEKILANKKP NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaagatcacaatcacagctgccatatgcctggtcttcctggccgctctcagcactgaa ggaatgagtgtgcggggaataggggtggatctgcggtgtcgctgtatcgagacggagagc cgacgaatggcgaaactcatccagagtgtggagctcttccctcccagtgcccactgcaag gacacggagatcattgccactctgaaagggactggtcagcagatctgtctggacaccacc gctccctgggtcaaaaaggtcatagagaaaatcctggccaacaagaagccctaa

DBGET integrated database retrieval system