Anguilla anguilla (European eel): 118227896 Help Entry 118227896         CDS       T07545                                  Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism aang  Anguilla anguilla (European eel) Pathway aang04010   MAPK signaling pathway aang04012   ErbB signaling pathway aang04068   FoxO signaling pathway aang04137   Mitophagy - animal aang04140   Autophagy - animal aang04144   Endocytosis aang04150   mTOR signaling pathway aang04210   Apoptosis aang04218   Cellular senescence aang04370   VEGF signaling pathway aang04371   Apelin signaling pathway aang04510   Focal adhesion aang04540   Gap junction aang04625   C-type lectin receptor signaling pathway aang04810   Regulation of actin cytoskeleton aang04910   Insulin signaling pathway aang04912   GnRH signaling pathway aang04916   Melanogenesis aang05132   Salmonella infection Brite KEGG Orthology (KO) [BR:aang00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118227896    04012 ErbB signaling pathway     118227896    04370 VEGF signaling pathway     118227896    04371 Apelin signaling pathway     118227896    04068 FoxO signaling pathway     118227896    04150 mTOR signaling pathway     118227896  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     118227896    04140 Autophagy - animal     118227896    04137 Mitophagy - animal     118227896   09143 Cell growth and death    04210 Apoptosis     118227896    04218 Cellular senescence     118227896   09144 Cellular community - eukaryotes    04510 Focal adhesion     118227896    04540 Gap junction     118227896   09142 Cell motility    04810 Regulation of actin cytoskeleton     118227896  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     118227896   09152 Endocrine system    04910 Insulin signaling pathway     118227896    04912 GnRH signaling pathway     118227896    04916 Melanogenesis     118227896  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118227896  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aang04131]     118227896   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aang04147]     118227896    04031 GTP-binding proteins [BR:aang04031]     118227896 Membrane trafficking [BR:aang04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     118227896  Endocytosis   Macropinocytosis    Ras GTPases     118227896 Exosome [BR:aang04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    118227896   Exosomal proteins of colorectal cancer cells    118227896 GTP-binding proteins [BR:aang04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     118227896 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N G-alpha ATP_bind_1 Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  118227896 NCBI-ProteinID:  XP_035274816 LinkDB All DBs Position 5:complement(54290622..54302100) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMNCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagctggtggtggttggagcaggtggcgtggggaagagtgcgctcacc atccagctcatccagaaccactttgtggatgagtacgaccccacaattgaggactcctac aggaagcaggtggtgattgacggggagacgtgcctgctggacatcctggacacagcgggt caggaggagtatagcgccatgcgggaccagtatatgaggactggggaaggcttcctctgt gtctttgccattaacaacaccaagtcctttgaggacattcaccagtacagagagcagatc aagcgggtgaaggactcggatgacgtgcccatggtgctggtgggcaacaagtgcgacctc ccggctcgcacggtggacacgcggcaagcgcaggatctggcccgcagctacggaattccc tacatcgagacctcggccaagacgcgccagggagtggaagatgccttctacacgctagtc cgtgagatcaggcagcacaagctgaggaaactgaacccgcctgatgagagtggccaggac tgcatgaattgccgttgtgtggtgtcatga

DBGET integrated database retrieval system