Anguilla anguilla (European eel): 118228079 Help Entry 118228079         CDS       T07545                                  Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism aang  Anguilla anguilla (European eel) Pathway aang04010   MAPK signaling pathway aang04137   Mitophagy - animal aang04140   Autophagy - animal aang04218   Cellular senescence aang04371   Apelin signaling pathway aang04625   C-type lectin receptor signaling pathway aang04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:aang00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118228079    04371 Apelin signaling pathway     118228079  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     118228079    04137 Mitophagy - animal     118228079   09143 Cell growth and death    04218 Cellular senescence     118228079   09142 Cell motility    04810 Regulation of actin cytoskeleton     118228079  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     118228079  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aang04147]     118228079    04031 GTP-binding proteins [BR:aang04031]     118228079 Exosome [BR:aang04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    118228079   Exosomal proteins of bladder cancer cells    118228079 GTP-binding proteins [BR:aang04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     118228079 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 SLFN-g3_helicase FeoB_N Motif Other DBs NCBI-GeneID:  118228079 NCBI-ProteinID:  XP_035275220 LinkDB All DBs Position 5:53127260..53151529 Genome browser AA seq 202 aa AA seqDB search MAGWKDGSVQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERAA RLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPM ILVGNKADLELQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQE CPPSPEPTRKEKDKSGCHCVIF NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atggctgggtggaaggatgggtcggtgcaggagaagtatcggctggttgtcgttggaggc ggtggtgtcgggaagtcagcattgactatccaattcatccagtcttactttgtcacggac tatgaccccacgatcgaggactcctacacgaagcagtgtgtgattgatgagagagcggct cgtctggatatcctggacacagcaggacaggaagagtttggggccatgagagagcagtac atgagaacgggcgagggcttcctgctcgtcttctccgtcaccgaccgagggagtttcgag gagatctacaagttccagaggcagatcctcagagtgaaagaccgagacgagtttcccatg atcctcgtcggcaacaaggcggacctggagctgcagagacaggtgactcaggaggagggc cagcagctggccaggcagctgaaggtaacgtacatggaggcctcggcaaagatccggatg aacgtagaccaagccttccacgagctggttagagtaataaggaaattccaggagcaagag tgcccaccctcaccagagcccactcgcaaagagaaggacaagagcggctgccattgtgtg atcttctga

DBGET integrated database retrieval system