Anguilla anguilla (European eel): 118229353 Help Entry 118229353         CDS       T07545                                  Name (RefSeq) C-C motif chemokine 25-like   KO K13072   C-C motif chemokine 25 Organism aang  Anguilla anguilla (European eel) Pathway aang04060   Cytokine-cytokine receptor interaction aang04672   Intestinal immune network for IgA production Brite KEGG Orthology (KO) [BR:aang00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     118229353  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     118229353  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aang04052]     118229353 Cytokines and neuropeptides [BR:aang04052]  Cytokines   Chemokines    118229353 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  118229353 NCBI-ProteinID:  XP_035277144 LinkDB All DBs Position 6:complement(288790..292487) Genome browser AA seq 99 aa AA seqDB search MRFGGLVFLLLLACIYLTLAQGSYEDCCLKYAKFVPKKIYRMAAAYRLQETDGGCNIPAI VFTLRRGRMFCADPSHRWAVDLIKRINSRKHLKKQMRQG NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgcgctttggtggcctggtcttcctcctgctcctcgcctgcatctacctcacgctggca caaggctcctatgaggattgctgtctgaagtatgccaaatttgtccccaagaagatctac cgtatggctgcggcataccggctacaagagaccgacggtggctgcaacatcccggcgatc gtgttcaccttgagaaggggcaggatgttctgtgctgaccccagtcaccgctgggcggtg gacctgataaagaggatcaacagtcgcaagcaccttaaaaagcagatgaggcagggctaa

DBGET integrated database retrieval system