Anguilla anguilla (European eel): 118232949 Help Entry 118232949         CDS       T07545                                  Symbol cdc42l Name (RefSeq) cell division cycle 42, like   KO K04393   cell division control protein 42 Organism aang  Anguilla anguilla (European eel) Pathway aang04010   MAPK signaling pathway aang04144   Endocytosis aang04370   VEGF signaling pathway aang04510   Focal adhesion aang04520   Adherens junction aang04530   Tight junction aang04810   Regulation of actin cytoskeleton aang04912   GnRH signaling pathway aang05100   Bacterial invasion of epithelial cells aang05132   Salmonella infection Brite KEGG Orthology (KO) [BR:aang00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118232949 (cdc42l)    04370 VEGF signaling pathway     118232949 (cdc42l)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     118232949 (cdc42l)   09144 Cellular community - eukaryotes    04510 Focal adhesion     118232949 (cdc42l)    04520 Adherens junction     118232949 (cdc42l)    04530 Tight junction     118232949 (cdc42l)   09142 Cell motility    04810 Regulation of actin cytoskeleton     118232949 (cdc42l)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     118232949 (cdc42l)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118232949 (cdc42l)    05100 Bacterial invasion of epithelial cells     118232949 (cdc42l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aang04131]     118232949 (cdc42l)    03036 Chromosome and associated proteins [BR:aang03036]     118232949 (cdc42l)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aang04147]     118232949 (cdc42l)    04031 GTP-binding proteins [BR:aang04031]     118232949 (cdc42l) Membrane trafficking [BR:aang04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     118232949 (cdc42l)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     118232949 (cdc42l)   Macropinocytosis    Ras GTPases     118232949 (cdc42l) Chromosome and associated proteins [BR:aang03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     118232949 (cdc42l) Exosome [BR:aang04147]  Exosomal proteins   Exosomal proteins of microglial cells    118232949 (cdc42l)   Exosomal proteins of breast milk    118232949 (cdc42l) GTP-binding proteins [BR:aang04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     118232949 (cdc42l) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  118232949 NCBI-ProteinID:  XP_035284102 LinkDB All DBs Position 1:complement(72166265..72172677) Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVREKWVPEISHHCPRTPFLLVGTQVDLR DDSNTVEKLAKNKQRPLPPESGDKLARELRAVKYVECSALTQRGLKNVFDEAILAALEPP ETKPKKRCSLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagaccataaagtgtgtggttgtgggggatggtgctgtcgggaagacctgcctgttg atctcctacacaaccaacaagttcccctctgaatatgtgcccacggtgtttgataactat gcagtcacggtgatgatcggtggggagccttacacacttggcctgttcgataccgcagga caggaagactacgacaggctgcggcccctgagctatccccagaccgacgtcttcctcgtc tgcttctccgtcgtgtcgccctcctcttttgagaacgtcagggagaagtgggttcctgag atctctcaccactgcccccgcacgcccttcctgctggtgggaactcaggtggacctccgg gatgacagtaacacggtggagaagctggccaagaacaaacagcgccccctgcctcccgag agcggtgacaagcttgcgcgggagctgcgcgctgtgaagtatgtggagtgctctgccctg acacagagaggactgaagaacgtgtttgatgaggctatcctcgctgctctggagcccccc gagaccaagcccaagaagcgctgctctttgctatag

DBGET integrated database retrieval system