Anguilla anguilla (European eel): 118234503 Help Entry 118234503         CDS       T07545                                  Name (RefSeq) elongin-C   KO K03872   elongin-C Organism aang  Anguilla anguilla (European eel) Pathway aang04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:aang00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     118234503  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:aang04121]     118234503    03400 DNA repair and recombination proteins [BR:aang03400]     118234503 Ubiquitin system [BR:aang04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      118234503    Cul5 complex      118234503 DNA repair and recombination proteins [BR:aang03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      118234503 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  118234503 NCBI-ProteinID:  XP_035286968 LinkDB All DBs Position 8:complement(12672030..12674899) Genome browser AA seq 112 aa AA seqDB search MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggatggtgaggagaagacctacggtggctgtgaagggccagatgccatgtatgtcaaa ctgatctcctctgatggccacgagttcattgtgaagagagaacacgccctgacatctggc actatcaaagctatgctgagcggtccaggccagtttgctgaaaatgaaaccaatgaagtg aatttccgggagattccatctcatgtcctgtcaaaagtctgcatgtacttcacctacaaa gtccgctacaccaacagctcaacggaaatcccagaattccccatcgctccagagatagcg cttgaactgctgatggctgcaaacttcttggattgttga

DBGET integrated database retrieval system