Anguilla anguilla (European eel): 118235396 Help Entry 118235396         CDS       T07545                                  Name (RefSeq) insulin-like   KO K04526   insulin Organism aang  Anguilla anguilla (European eel) Pathway aang04010   MAPK signaling pathway aang04068   FoxO signaling pathway aang04081   Hormone signaling aang04114   Oocyte meiosis aang04140   Autophagy - animal aang04150   mTOR signaling pathway aang04810   Regulation of actin cytoskeleton aang04910   Insulin signaling pathway aang04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:aang00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118235396    04068 FoxO signaling pathway     118235396    04150 mTOR signaling pathway     118235396   09133 Signaling molecules and interaction    04081 Hormone signaling     118235396  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     118235396   09143 Cell growth and death    04114 Oocyte meiosis     118235396   09142 Cell motility    04810 Regulation of actin cytoskeleton     118235396  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     118235396    04914 Progesterone-mediated oocyte maturation     118235396  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aang04052]     118235396 Cytokines and neuropeptides [BR:aang04052]  Neuropeptides   Unclassified    118235396 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Chi-conotoxin Motif Other DBs NCBI-GeneID:  118235396 NCBI-ProteinID:  XP_035288546 LinkDB All DBs Position 9:complement(33726687..33728367) Genome browser AA seq 110 aa AA seqDB search MASCLPVISLLVLLVLSSPGADAGSTQHLCGSHLVDALYLVCGDKGFFFNPKTKRDVEPL LGFLSPKSGQENEVDDFPYKGQGELKVKRGIVEQCCHKPCNIFDLQNYCN NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggcatcctgcctgccggtaatctccctactggtgctgctcgtcctatccagtcctggg gctgatgccgggtcaacccaacacctgtgtgggtctcacctggtcgacgccctctacctg gtgtgcggagataaagggttcttcttcaaccccaagaccaagcgggacgtggagcctctg ctgggattcctctctccaaaatcaggccaggagaacgaggtggatgatttcccctacaaa ggtcagggggaactgaaggtgaagaggggcattgtggagcagtgctgtcacaagccctgc aacatcttcgacctacagaattactgcaactga

DBGET integrated database retrieval system