KEGG   Aquirufa antheringensis: G9X63_02555
Entry
G9X63_02555       CDS       T08298                                 
Name
(GenBank) NADH-quinone oxidoreductase subunit J
  KO
K00339  NADH-quinone oxidoreductase subunit J [EC:7.1.1.2]
Organism
aanh  Aquirufa antheringensis
Pathway
aanh00190  Oxidative phosphorylation
aanh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aanh00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    G9X63_02555
Enzymes [BR:aanh01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     G9X63_02555
SSDB
Motif
Pfam: Oxidored_q3 DUF6541 DUF6057 MbhD Acyl_transf_3
Other DBs
NCBI-ProteinID: USQ03033
LinkDB
Position
543791..544306
AA seq 171 aa
MEISNIWYFLSGLTLLSALMVVLAKNPIHSVLYLVFTFFCISGHYVLLNAQFLMAVNIIV
YAGAIMVLFLFVIMMFDLRKNQPESKSNLTKLAGSVVAGSLLVVLIALVRQNNFQTPLAD
GFVSQTGMVENLGKVLYSEYLLPFELVSILFFVAMVGAVLLGKREAGERNF
NT seq 516 nt   +upstreamnt  +downstreamnt
atggagatttctaatatttggtattttctttcaggtttaactttactaagcgccctaatg
gtcgttctagcaaagaacccgattcactcagtcttgtacttggtgtttactttcttttgc
atctcaggtcactacgtcctgttaaatgcccagttcttgatggcggtgaatatcatcgtt
tacgcgggagctatcatggttttattcctattcgtgatcatgatgtttgatctgcgcaag
aatcaaccggaatcaaaatcgaatctaacaaagctagcgggctcagtggtcgctggttct
ttattagtggttttaatcgctttagtgcgtcaaaataacttccagactcctttagcggat
ggatttgtgtctcaaaccggtatggtggagaaccttggtaaggttttgtattctgagtac
ttattgcctttcgagctggtatctatcttgttctttgtggcgatggtgggtgcggttctt
ttggggaagagagaagcaggggagcgaaacttttaa

DBGET integrated database retrieval system