Aquirufa antheringensis: G9X63_04275 Help Entry G9X63_04275       CDS       T08298                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aanh  Aquirufa antheringensis Pathway aanh01100   Metabolic pathways aanh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aanh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G9X63_04275    00074 Mycolic acid biosynthesis     G9X63_04275   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G9X63_04275 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  USQ03353 LinkDB All DBs Position complement(920900..921127) Genome browser AA seq 75 aa AA seqDB search MENRIKEIIVAILKESGNYKEDIKFEPSSHLRDDLGMDSFNLAELTVYVEEEFDIDIFED GIVNTVSEIYAKLSK NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggaaaatagaataaaggaaattattgtagctattcttaaagagtcgggtaattacaaa gaggacattaaatttgaaccatcatctcatttaagagatgacctaggaatggattccttt aatttggcagagttaactgtttatgttgaggaagagtttgatatagatatttttgaagac gggatagtaaacacagtttcagaaatctatgcaaaacttagcaaatag

DBGET integrated database retrieval system