Argentina anserina (silverweed cinquefoil): 126785756
Help
Entry
126785756 CDS
T10558
Name
(RefSeq) SKP1-like protein 1A
KO
K03094
S-phase kinase-associated protein 1
Organism
aans Argentina anserina (silverweed cinquefoil)
Pathway
aans03083
Polycomb repressive complex
aans04120
Ubiquitin mediated proteolysis
aans04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
aans00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
126785756
04120 Ubiquitin mediated proteolysis
126785756
09126 Chromosome
03083 Polycomb repressive complex
126785756
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
aans04131
]
126785756
04121 Ubiquitin system [BR:
aans04121
]
126785756
03036 Chromosome and associated proteins [BR:
aans03036
]
126785756
Membrane trafficking [BR:
aans04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
126785756
Ubiquitin system [BR:
aans04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
126785756
Cul7 complex
126785756
Chromosome and associated proteins [BR:
aans03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
126785756
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
126785756
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1_POZ
Skp1
FAP206
Motif
Other DBs
NCBI-GeneID:
126785756
NCBI-ProteinID:
XP_050367352
LinkDB
All DBs
Position
3:3439741..3440160
Genome browser
AA seq
139 aa
AA seq
DB search
MSRVFKLRSSDNETFEIEEAAAMLSKTIKSSSSADIEVPNVKAEILGKVVEWCNKHAERE
GIEDQLIKEWDAELLNVDQDVLFKLITAADYLQIKELVDQLTQRVADMIRAKTFKTVEMT
RMTFDIKREVQEELKSVGF
NT seq
420 nt
NT seq
+upstream
nt +downstream
nt
atgtctcgagttttcaaactgaggagctccgacaatgagacattcgaaattgaagaagct
gcagcgatgctctctaaaaccatcaagagctcgtcgtccgccgacattgaagtgccaaac
gtgaaggcagaaattttaggcaaggtggtggagtggtgcaacaagcatgcagagagagaa
ggcattgaagatcaactcatcaaagagtgggacgctgagttacttaatgtcgaccaagat
gttctgttcaagctgataacagctgcagattatctacagattaaagaactggtggatcaa
ttaactcaaagagttgcggacatgattagggcaaagacatttaagacggtagaaatgact
cgcatgacatttgacatcaagagagaagtgcaagaagaattaaaatcagtggggttctaa
DBGET
integrated database retrieval system