Comamonas antarctica: HUK68_03735 Help Entry HUK68_03735       CDS       T07217                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism aant  Comamonas antarctica Brite KEGG Orthology (KO) [BR:aant00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:aant03110]     HUK68_03735 (grxC) Chaperones and folding catalysts [BR:aant03110]  Protein folding catalysts   Protein disulfide isomerase    HUK68_03735 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like Thioredoxin_2 Motif Other DBs NCBI-ProteinID:  QKV52081 UniProt:  A0A6N1WYD6 LinkDB All DBs Position 791060..791317 Genome browser AA seq 85 aa AA seqDB search MQAVKMYTTAVCPYCIRAKQILKSKGVEQIEEIRIDLDPSARDQMMQSTGRRTVPQIFIG ATHVGGCDDLIALDSQGGLQPLLAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagctgtaaagatgtacaccaccgccgtctgcccttactgcatccgtgcaaagcag attctcaaatccaagggtgtggagcagatcgaggaaatccgcattgatctggacccgtcc gcgcgcgaccagatgatgcaatcgacgggccgccgcacggtgccgcagatcttcatcggc gcgacccatgtcggcggttgcgacgacctgatcgcactggactcccagggcggtctccag ccgctgctcgcggcctga

DBGET integrated database retrieval system