KEGG   Comamonas antarctica: HUK68_17330
Entry
HUK68_17330       CDS       T07217                                 
Symbol
cheY
Name
(GenBank) chemotaxis protein CheY
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
aant  Comamonas antarctica
Pathway
aant02020  Two-component system
aant02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:aant00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HUK68_17330 (cheY)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    HUK68_17330 (cheY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:aant02022]
    HUK68_17330 (cheY)
   02035 Bacterial motility proteins [BR:aant02035]
    HUK68_17330 (cheY)
Two-component system [BR:aant02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   HUK68_17330 (cheY)
Bacterial motility proteins [BR:aant02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    HUK68_17330 (cheY)
SSDB
Motif
Pfam: Response_reg
Other DBs
NCBI-ProteinID: QKV54510
UniProt: A0A6N1X9I9
LinkDB
Position
3728935..3729321
AA seq 128 aa
MANALRFLIVDDFSTMRRIVRNLLKESGFPEADEAEDGVVALHKLRNSKFDFVVTDINMP
NMNGFQLLAEIKSDEKLKHLPVLMVTAEARKEDIVAAAQNGAAGYIVKPFTKATLEEKVG
LILKKLGL
NT seq 387 nt   +upstreamnt  +downstreamnt
gtggctaatgccttgcgttttttgatcgtcgacgacttctccaccatgcgccgcatcgtg
cgcaaccttctcaaggaaagcggtttccccgaggcggatgaggcggaggatggcgtcgtt
gcgctgcacaagctgcgcaacagcaagttcgatttcgtcgtcaccgacatcaacatgccc
aacatgaacggcttccagctgctcgccgaaatcaagtcggacgagaagctcaagcatctt
ccagtgctgatggtcacggccgaagcgcgcaaggaagacatcgtggccgcggcgcaaaac
ggcgcggcgggctatatcgtcaagccgttcaccaaggccacgctggaagaaaaggtcggc
ctgatcctgaagaagctggggctgtaa

DBGET integrated database retrieval system