Aggregatibacter aphrophilus NJ8700: NT05HA_1481 Help Entry NT05HA_1481       CDS       T00929                                  Name (GenBank) DNA-binding protein   KO K03557   Fis family transcriptional regulator, factor for inversion stimulation protein Organism aap  Aggregatibacter aphrophilus NJ8700 Brite KEGG Orthology (KO) [BR:aap00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:aap03000]     NT05HA_1481    03036 Chromosome and associated proteins [BR:aap03036]     NT05HA_1481    03400 DNA repair and recombination proteins [BR:aap03400]     NT05HA_1481 Transcription factors [BR:aap03000]  Prokaryotic type   Helix-turn-helix    Other families     NT05HA_1481 Chromosome and associated proteins [BR:aap03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     NT05HA_1481 DNA repair and recombination proteins [BR:aap03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Facilitator       NT05HA_1481 SSDB OrthologParalogGFIT Motif Pfam:  Fis_N HTH_8 HTH_30 Phage_NinH HetZ HTH_28 TAtT INT1_R3 MHB CNOT1_HEAT_N Xre-like-HTH Motif Other DBs NCBI-ProteinID:  ACS97822 LinkDB All DBs Position complement(1487148..1487444) Genome browser AA seq 98 aa AA seqDB search MLEQRNPAEALTVSVLNSQSQVTNKPLRDSVKQALRNYLSQLDGQDVNDLYELVLAEVEH PMLDMVMQYTRGNQTRAATMLGINRGTLRKKLKKYGMG NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgttagaacaacgtaatccggcggaagcattaactgtttcagtgctgaattctcaatct caagtaaccaacaaaccattgcgcgactctgtaaaacaagcgttaagaaattatttatcc caattagacggtcaagatgtgaatgatctgtatgaattggtattggcagaagtcgaacac ccaatgttggatatggttatgcaatatactcgtggcaatcaaacccgcgctgcaacaatg ctcggcatcaaccgtggcaccttgcgtaaaaaattaaaaaaatacggtatgggttag

DBGET integrated database retrieval system