Apilactobacillus apisilvae: MOO46_04350 Help Entry MOO46_04350       CDS       T08479                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aapi  Apilactobacillus apisilvae Pathway aapi01100   Metabolic pathways aapi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aapi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MOO46_04350    00074 Mycolic acid biosynthesis     MOO46_04350   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MOO46_04350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  UQS84491 LinkDB All DBs Position complement(840704..840949) Genome browser AA seq 81 aa AA seqDB search MADKNAIFDKVKEIVVDQSDVKAEDIKMETKFQDELDLDSLDLFEIIDALEDEYDIEIDT DNDIATVQQLVDYVAKQVDEK NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggcagacaagaacgcaatttttgacaaggtaaaagaaatcgttgtagaccaatcagat gttaaggctgaagatattaaaatggaaactaaattccaagacgaattagacttagatagt ttagacctattcgaaatcatcgatgcactagaagatgaatacgatatcgaaattgatact gataacgatattgcaactgttcaacaactagttgattacgttgcaaaacaagttgacgaa aagtaa

DBGET integrated database retrieval system