Apirhabdus apintestini: QNH14_23630 Help Entry QNH14_23630       CDS       T09955                                  Name (GenBank) DinI-like family protein   KO K12149   DNA-damage-inducible protein I Organism aapt  Apirhabdus apintestini Brite KEGG Orthology (KO) [BR:aapt00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:aapt03400]     QNH14_23630 DNA repair and recombination proteins [BR:aapt03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     QNH14_23630 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI HEPN_Swt1 Motif Other DBs NCBI-ProteinID:  WPM86252 LinkDB All DBs Position unnamed2:complement(48057..48302) Genome browser AA seq 81 aa AA seqDB search MLQVSVRFSPEQVKAMPAGAFAALQQEIERRLTPHYPSLWLNVSKGSQSSLSVSGARNDR EKADVMEALEAIWLDDSWLPL NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgctacaggtttcagtacgtttttctccggaacaggtaaaggccatgcccgccggggca tttgccgctctacagcaggaaattgagcgacgcctgacgccacattatccgtcactatgg ctcaacgtcagcaagggatcacagagcagcctgagcgttagcggcgcccgaaatgaccgg gagaaggctgacgtcatggaagcgctggaggctatctggctcgacgacagctggctgcct ctgtaa

DBGET integrated database retrieval system