Anopheles arabiensis: 120897396 Help Entry 120897396         CDS       T07381                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism aara  Anopheles arabiensis Pathway aara04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:aara00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     120897396  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:aara04121]     120897396    03400 DNA repair and recombination proteins [BR:aara03400]     120897396 Ubiquitin system [BR:aara04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      120897396    Cul5 complex      120897396 DNA repair and recombination proteins [BR:aara03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      120897396 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin GABP-alpha Rad60-SLD Motif Other DBs NCBI-GeneID:  120897396 NCBI-ProteinID:  XP_040158178 UniProt:  A0A182HJ43 LinkDB All DBs Position 2:32804295..32806587 Genome browser AA seq 117 aa AA seqDB search MDVFMMIRRKKTTIFTDAKETTPVYELKKMIEGILKVPPRDQRLYNKDNMLMDDDKTLQD CGITVVTAKAQCPAQLGLAVRENGDFESLELTPYSLPPDLPDVMKNQDTANGQDQLA NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggatgtatttatgatgatccggcggaagaagacgacgattttcaccgatgccaaagag acgacgccggtgtacgagctgaagaaaatgatcgaaggaatactcaaagtgcctccccgt gatcaacgactatacaacaaagacaacatgctgatggacgatgacaaaacgctgcaggac tgcggcatcacggtcgtgacagcgaaagcgcaatgccccgcacagctcggcctagcggtg cgcgaaaatggcgacttcgagtcgctcgagctgacaccctactccctgccgcccgaccta ccggacgtgatgaaaaaccaggataccgccaacggccaggaccagctcgcctaa

DBGET integrated database retrieval system