Anopheles arabiensis: 120898300
Help
Entry
120898300 CDS
T07381
Name
(RefSeq) phosphoglycerate mutase 2-like
KO
K01834
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:
5.4.2.11
]
Organism
aara
Anopheles arabiensis
Pathway
aara00010
Glycolysis / Gluconeogenesis
aara00260
Glycine, serine and threonine metabolism
aara01100
Metabolic pathways
aara01200
Carbon metabolism
aara01230
Biosynthesis of amino acids
Module
aara_M00001
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
aara_M00002
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:
aara00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00010 Glycolysis / Gluconeogenesis
120898300
09105 Amino acid metabolism
00260 Glycine, serine and threonine metabolism
120898300
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
aara04131
]
120898300
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:
aara04147
]
120898300
Enzymes [BR:
aara01000
]
5. Isomerases
5.4 Intramolecular transferases
5.4.2 Phosphotransferases (phosphomutases)
5.4.2.11 phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
120898300
Membrane trafficking [BR:
aara04131
]
Autophagy
Chaperone mediated autophagy (CMA)
Selective cargos
120898300
Exosome [BR:
aara04147
]
Exosomal proteins
Exosomal proteins of bladder cancer cells
120898300
Exosomal proteins of melanoma cells
120898300
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
His_Phos_1
Motif
Other DBs
NCBI-GeneID:
120898300
NCBI-ProteinID:
XP_040159887
UniProt:
A0A182HKU3
LinkDB
All DBs
Position
2:complement(4679946..4681297)
Genome browser
AA seq
255 aa
AA seq
DB search
MAAKYRIVMVRHGESEWNQKNLFCGWFDANLSDKGKEEALAAGKAVKEAGLKFDIAHTSL
LTRAQVTLDSILKESGQTSIPIQKTWRLNERHYGGLTGLNKSETAAKYGEEQVLIWRRSF
DVPPPNMEPDHAYYDAIVKDERYKDDPKPNEFPMAESLKLTIARTLPYWNDVIIPQLKEG
KNIIIAAHGNSLRGIVKHLDQMTDEAIMGLNLPTGIPFVYELDENLKPVVSMKFLGDEET
VRKAIESVANQGKAK
NT seq
768 nt
NT seq
+upstream
nt +downstream
nt
atggccgcaaagtaccgcattgtgatggttcgccacggcgaatcggagtggaaccagaag
aatctgttctgcggctggttcgatgctaacctgagcgacaagggtaaggaggaagccctg
gccgccggaaaggccgtgaaggaggcgggcctgaagttcgacattgcccacacgtcgctg
ctcacccgtgcccaggtcacgctggactcgatcctgaaggagtcgggccaaacgagcatc
ccgatccagaagacctggcgcctgaacgagcgccactacggtggcctgaccgggctgaac
aagtccgaaacggcggccaagtatggcgaggagcaggtgctgatctggcgccgcagcttc
gatgttcccccgcccaacatggaaccggaccatgcctactacgatgcgatcgtcaaggac
gagcggtacaaggacgacccgaaaccgaacgagttcccgatggccgaatcgctgaagctg
acgatcgcccgcaccctgccgtactggaacgacgttatcattccgcagctgaaggagggc
aagaacattatcattgccgcgcacggcaacagcctgcgcggtatcgtgaagcatctggac
cagatgacggatgaggcgatcatgggcctgaacctacccaccggcatcccgttcgtgtac
gagctggacgagaacctgaagccggtcgtgtcgatgaagttcctcggcgatgaggagacg
gtccgcaaggcgatcgaatccgtcgctaaccagggcaaggccaagtaa
DBGET
integrated database retrieval system