KEGG   Anopheles arabiensis: 120898543
Entry
120898543         CDS       T07381                                 
Name
(RefSeq) cytochrome P450 306a1-like isoform X1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
aara  Anopheles arabiensis
Pathway
aara00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:aara00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    120898543
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:aara00199]
    120898543
Enzymes [BR:aara01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     120898543
Cytochrome P450 [BR:aara00199]
 Cytochrome P450, animal type
  CYP306 family
   120898543
SSDB
Motif
Pfam: p450 DUF22
Other DBs
NCBI-GeneID: 120898543
NCBI-ProteinID: XP_040160469
LinkDB
Position
2:complement(57901924..57982254)
AA seq 505 aa
MIMLMCLVILLLFCCIFITLLSRHKKPPGPYGFPFIGCLTLIDPLKPYETFSRLARQYGT
TYGLWMGQVYTVVLTDPTLIRTILSKDEATGRAPLFITHGIMGGHGIICAQGNLWRDQRR
LSIDWLRKLGMVKYGCARLNLERRINSGLIEMLQDIDNMVDKTPQGLNPSPIIHHVLGNL
LNDLVFGIKYEKNNVTWKYLQHLQEEGVKHIGVSMAVNFLPFLRYLPSTRRTINFLLSGK
HQTHAIYDALISNQRSKLRSCDTFIEEQEECILTYFLKEAAKRQEAGRPDAAFCDDIQLR
HLMADLFGAGVDTTFTTIRWALLYIALYPTVQKRLREELRQRLVVNEPPSLKDVEALPYL
RATIAEVQRIRTVVPLGIPHGTTKEIKIGDFKIPSNTMIMPVVWAVHMNPILFNAPNTFK
PERFLDLEGRFSIPNYFLPFQVGKRMCLGEELARNILHLYIANIVYHYDWIRISPEDAML
IDLTGNCGLTLTPPDYIIIFSKNNK
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgataatgctgatgtgtttagtaattttgttattgttttgctgtatcttcataactttg
ttgagccgacacaaaaagcctccgggaccatatggttttccatttattggatgtttaaca
ttaattgaccctcttaaaccatacgaaactttttctcgacttgcacgacaatatggtact
acatacgggttgtggatgggacaagtttatactgtagtactaactgatcctaccttaatt
cgaaccattttgtcaaaggatgaagccaccggtcgagcacccttgtttattacacacggt
ataatgggaggtcatggaatcatttgcgctcaaggtaatttatggcgcgatcaacgccga
ttatcaatcgattggcttcgtaaattgggaatggttaagtatggatgtgctcgattaaat
cttgaacggagaattaattctggacttatcgaaatgcttcaggacattgataatatggta
gataagacaccacaaggtttaaacccatctcctatcatacatcacgtgctcggaaattta
ttaaatgatttagtttttggtataaaatacgaaaagaacaatgttacatggaaatattta
cagcaccttcaagaagaaggtgtgaagcatattggagtatctatggctgtgaacttctta
ccatttttgagatatttaccttctactcgtagaacaatcaattttcttctcagtggaaaa
catcaaacacatgctatttatgatgctttgatatccaatcaacgaagcaagttgcgttct
tgtgatacatttattgaagagcaggaggagtgcatattaacatattttttaaaagaagcc
gcaaaacgacaagaagcaggtcgaccggatgctgcattttgcgatgacatacagctacgc
catttgatggcagacttgttcggggcaggtgtggatactacatttactacgattcgatgg
gctttgctatatatcgccctatatccaactgttcaaaagcgtcttcgagaagaactgaga
caaagactggtcgtgaatgagccaccttcgttgaaagatgtggaggctttgccctattta
cgggcaaccatcgcggaagtgcagcgaattcgtaccgttgttccgcttggtatacctcat
ggaacaactaaggaaataaagattggtgattttaaaattccatcaaatacaatgatcatg
cctgtagtatgggctgtgcacatgaatcctatactattcaacgcgcctaacactttcaag
ccagaacggttcctggatttagaggggcgcttctccattccaaactactttcttccattt
caagtcggcaaacgtatgtgtttgggcgaagagcttgctagaaatattcttcatttgtac
atcgccaatatagtgtatcattacgattggattcggatatctcctgaggatgctatgttg
atcgatttaacaggaaattgtggattaaccttaactcccccagactatataattatattc
tcgaaaaataataaataa

DBGET integrated database retrieval system