Anopheles arabiensis: 120902312 Help Entry 120902312         CDS       T07381                                  Name (RefSeq) prostaglandin E synthase-like   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism aara  Anopheles arabiensis Pathway aara00480   Glutathione metabolism aara00980   Metabolism of xenobiotics by cytochrome P450 aara00982   Drug metabolism - cytochrome P450 aara00983   Drug metabolism - other enzymes aara01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:aara00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     120902312   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     120902312    00982 Drug metabolism - cytochrome P450     120902312    00983 Drug metabolism - other enzymes     120902312  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:aara02000]     120902312 Enzymes [BR:aara01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      120902312 Transporters [BR:aara02000]  Other transporters   Pores ion channels [TC:1]    120902312 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MAPEG Motif Other DBs NCBI-GeneID:  120902312 NCBI-ProteinID:  XP_040166913 UniProt:  A0A182HRD7 LinkDB All DBs Position 3:44524731..44525800 Genome browser AA seq 147 aa AA seqDB search MSLVFGQVEPAVFQAYAFWAAVLGLKMLLMSVLTGLKRGSKKVFSNPEDVKPGGKVAYDD PDVERVRRAHRNDMENISPYFIIGFLYMFTNPSVTVATNLFRLVAVVRISHTVFHVLVPV HKFRGMSWAIGFFTTAFMGVQIVLHFL NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgtcgctagtgttcggacaagtcgagccggccgtttttcaagcctatgccttttgggca gccgtacttgggctcaagatgctgctcatgtctgtgctgactggcctgaagcgtggctcc aaaaaggtcttttcgaatccggaagacgttaagccgggtggcaaggttgcgtatgacgat ccggatgtggaacgtgttcgacgcgcccatcggaatgatatggaaaatatttcaccctac ttcatcatcggcttcctgtacatgttcaccaatccgagtgtgaccgttgcgaccaacctg ttccgtctagtagcggtcgttcgcatcagccacacggtgtttcacgtactcgttccagtg cacaagtttcggggtatgtcctgggcaatcggtttcttcacgaccgccttcatgggcgta cagatagtgctgcattttctgtag

DBGET integrated database retrieval system