Agromyces archimandritae: G127AT_00720 Help Entry G127AT_00720      CDS       T08034                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aarc  Agromyces archimandritae Pathway aarc01100   Metabolic pathways aarc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aarc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G127AT_00720    00074 Mycolic acid biosynthesis     G127AT_00720   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G127AT_00720 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QTX04831 UniProt:  A0A975FPJ8 LinkDB All DBs Position 144453..144701 Genome browser AA seq 82 aa AA seqDB search MAQSTEEVLAGLAELINDETGIATDTVELDKSFTDDLDIDSISMMTIVVNAEEKFDVKIP DEEVKNLKSVGDAVEFIVKAQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcccagtccaccgaagaagtcctcgccggcctggccgagctcatcaacgacgagacc ggcatcgccaccgacacggtcgagctggacaagtcgttcaccgacgacctcgacatcgac tcgatctccatgatgacgatcgtcgtcaacgccgaggagaagttcgacgtgaagatcccc gacgaagaggtcaagaacctcaagtccgtcggcgacgccgtcgagttcatcgtcaaggct caggcctga

DBGET integrated database retrieval system